| Clone Name | bags17c20 |
|---|---|
| Clone Library Name | barley_pub |
>YIAO_ECOLI (P37676) 2,3-diketo-L-gulonate-binding periplasmic protein yiaO| precursor (2,3-DKG-binding protein) (Extracytoplasmic solute receptor protein yiaO) Length = 328 Score = 31.2 bits (69), Expect = 2.3 Identities = 22/60 (36%), Positives = 30/60 (50%) Frame = +2 Query: 59 RYVTWSLHNKNRAGLRHFLDSFVAPEQLCANTHTAHSAGLHEQSSGLNDNKQDRPKGELK 238 R VT++L AGL F S +A + L T+ + H + ND Q+R KGELK Sbjct: 4 RSVTYALFI---AGLAAFSTSSLAAQSLRFGYETSQTDSQHIAAKKFNDLLQERTKGELK 60
>1B46_HUMAN (P30484) HLA class I histocompatibility antigen, B-46 alpha chain| precursor (MHC class I antigen B*46) (Bw-46) Length = 362 Score = 30.8 bits (68), Expect = 3.0 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = +3 Query: 303 WTARSGTEGWRPHLSDLCMHWFTRFFMGSK 392 W A E WR +L LC+ W R+ K Sbjct: 171 WEAAREAEQWRAYLEGLCVEWLRRYLENGK 200
>1B15_HUMAN (P30464) HLA class I histocompatibility antigen, B-15 alpha chain| precursor (MHC class I antigen B*15) Length = 362 Score = 30.8 bits (68), Expect = 3.0 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = +3 Query: 303 WTARSGTEGWRPHLSDLCMHWFTRFFMGSK 392 W A E WR +L LC+ W R+ K Sbjct: 171 WEAAREAEQWRAYLEGLCVEWLRRYLENGK 200
>SEC16_SCHPO (O14029) Multidomain vesicle coat protein| Length = 1995 Score = 30.4 bits (67), Expect = 3.9 Identities = 22/69 (31%), Positives = 32/69 (46%) Frame = +2 Query: 44 LESTTRYVTWSLHNKNRAGLRHFLDSFVAPEQLCANTHTAHSAGLHEQSSGLNDNKQDRP 223 LES T+ +HN+N +G LD FVA + + +T S LND K + P Sbjct: 318 LESENNESTFFVHNQNSSGQHQTLD-FVASKPV-TDTPELSKENTLVSSENLNDPKPNLP 375 Query: 224 KGELKSSHP 250 + E+ P Sbjct: 376 ETEVDFGEP 384
>HA1B_BOVIN (P13753) BOLA class I histocompatibility antigen, alpha chain BL3-7| precursor Length = 364 Score = 30.0 bits (66), Expect = 5.0 Identities = 11/34 (32%), Positives = 14/34 (41%) Frame = +3 Query: 303 WTARSGTEGWRPHLSDLCMHWFTRFFMGSKSIFL 404 W A E WR +L C+ W R+ K L Sbjct: 174 WEAAGAAETWRNYLEGECVEWLRRYLENGKDTLL 207
>UXAC_BACSU (O34808) Uronate isomerase (EC 5.3.1.12) (Glucuronate isomerase)| (Uronic isomerase) Length = 473 Score = 29.3 bits (64), Expect = 8.6 Identities = 20/63 (31%), Positives = 29/63 (46%), Gaps = 10/63 (15%) Frame = -1 Query: 383 HEKSGEPVHTQVAQM-RAPAFGSR---------ACCPRDPPVSFLTHHLMDLSLKDD*IS 234 +EKSG + Q ++ + FG+R C D PV L +HL+ KD +S Sbjct: 119 NEKSGSAIWKQTNKLLKGEGFGARDLIVKSNVKVVCTTDDPVDSLEYHLLLKEDKDFPVS 178 Query: 233 ALP 225 LP Sbjct: 179 VLP 181
>KAX12_LEIQH (P45628) Potassium channel toxin alpha-KTx 1.2 precursor| (Charybdotoxin-2) (ChTX-Lq2) (Toxin 18-2) (Lqh 18-2) (ChTx-d) Length = 59 Score = 29.3 bits (64), Expect = 8.6 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = -3 Query: 201 FNPEDCSCSPAEWAVCVLAHNCSGATNESRKCR 103 F E C+ S W++C HN + ++KCR Sbjct: 24 FTQESCTASNQCWSICKRLHNTNRGKCMNKKCR 56 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 84,250,619 Number of Sequences: 219361 Number of extensions: 1743877 Number of successful extensions: 4859 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 4716 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4859 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4986986160 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)