| Clone Name | bags16j08 |
|---|---|
| Clone Library Name | barley_pub |
>EFP_SYNEL (Q8DJD3) Elongation factor P (EF-P)| Length = 185 Score = 33.9 bits (76), Expect = 0.33 Identities = 21/52 (40%), Positives = 31/52 (59%) Frame = -1 Query: 214 RAGLDVLLDVAVHRLVGALLHVRPGEAGLEVRRHLAHLHRADLVVQRTHRHG 59 R G+ + LD AV R+V LHV+PG+ VR L ++ + V++RT R G Sbjct: 8 RPGVSIELDGAVWRVV-EFLHVKPGKGSAFVRTKLKNVQTGN-VIERTFRAG 57
>EFP_LACPL (Q88WN1) Elongation factor P (EF-P)| Length = 185 Score = 32.3 bits (72), Expect = 0.95 Identities = 21/58 (36%), Positives = 31/58 (53%) Frame = -1 Query: 208 GLDVLLDVAVHRLVGALLHVRPGEAGLEVRRHLAHLHRADLVVQRTHRHGRDLGDLPL 35 GL + +D A+ R+V HV+PG+ G VR L +L R V +T R G + P+ Sbjct: 10 GLTIEVDNAIWRIV-EFQHVKPGKGGAFVRSKLKNL-RTGAVQDKTFRAGARMEQAPI 65
>EFP_PROMM (Q7V9B9) Elongation factor P (EF-P)| Length = 186 Score = 32.3 bits (72), Expect = 0.95 Identities = 25/66 (37%), Positives = 36/66 (54%) Frame = -1 Query: 214 RAGLDVLLDVAVHRLVGALLHVRPGEAGLEVRRHLAHLHRADLVVQRTHRHGRDLGDLPL 35 R G + LD +V R+V LHV+PG+ VR L + + VV++T R G LP Sbjct: 8 RTGTSIELDGSVWRVV-EFLHVKPGKGSAFVRTKLKAVQSGN-VVEKTFRAGE---MLPQ 62 Query: 34 SLLVRS 17 +LL +S Sbjct: 63 ALLEKS 68
>EFP_SYNY3 (Q55119) Elongation factor P (EF-P)| Length = 187 Score = 31.6 bits (70), Expect = 1.6 Identities = 19/52 (36%), Positives = 30/52 (57%) Frame = -1 Query: 214 RAGLDVLLDVAVHRLVGALLHVRPGEAGLEVRRHLAHLHRADLVVQRTHRHG 59 R G +++D AV ++V LHV+PG+ VR L + + VV++T R G Sbjct: 8 RTGTSIVMDGAVWKVV-EFLHVKPGKGSAFVRTKLKSVQTGN-VVEKTFRAG 57
>EFP_PROMA (Q7VEI7) Elongation factor P (EF-P)| Length = 186 Score = 31.6 bits (70), Expect = 1.6 Identities = 22/52 (42%), Positives = 30/52 (57%) Frame = -1 Query: 214 RAGLDVLLDVAVHRLVGALLHVRPGEAGLEVRRHLAHLHRADLVVQRTHRHG 59 R G + LD AV R+V LHV+PG+ VR L + +A VV++T R G Sbjct: 8 RTGTTIELDGAVWRVV-EFLHVKPGKGSAFVRTKLKAV-QAGNVVEKTFRAG 57
>EFP_SYNP7 (Q54760) Elongation factor P (EF-P)| Length = 185 Score = 30.8 bits (68), Expect = 2.8 Identities = 23/66 (34%), Positives = 36/66 (54%) Frame = -1 Query: 214 RAGLDVLLDVAVHRLVGALLHVRPGEAGLEVRRHLAHLHRADLVVQRTHRHGRDLGDLPL 35 R G + +D AV R+V LHV+PG+ VR L + + VV++T R G +P Sbjct: 8 RTGTTIEIDGAVWRVV-EFLHVKPGKGSAFVRTKLKNAKTGN-VVEKTFRAGE---TVPQ 62 Query: 34 SLLVRS 17 ++L +S Sbjct: 63 AVLEKS 68
>EFP_SYNP6 (Q5N1T5) Elongation factor P (EF-P)| Length = 185 Score = 30.8 bits (68), Expect = 2.8 Identities = 23/66 (34%), Positives = 36/66 (54%) Frame = -1 Query: 214 RAGLDVLLDVAVHRLVGALLHVRPGEAGLEVRRHLAHLHRADLVVQRTHRHGRDLGDLPL 35 R G + +D AV R+V LHV+PG+ VR L + + VV++T R G +P Sbjct: 8 RTGTTIEIDGAVWRVV-EFLHVKPGKGSAFVRTKLKNAKTGN-VVEKTFRAGE---TVPQ 62 Query: 34 SLLVRS 17 ++L +S Sbjct: 63 AVLEKS 68
>EFP_SYNPX (Q7UA67) Elongation factor P (EF-P)| Length = 187 Score = 30.8 bits (68), Expect = 2.8 Identities = 24/66 (36%), Positives = 36/66 (54%) Frame = -1 Query: 214 RAGLDVLLDVAVHRLVGALLHVRPGEAGLEVRRHLAHLHRADLVVQRTHRHGRDLGDLPL 35 R G + +D AV R+V LHV+PG+ VR L + + VV++T R G LP Sbjct: 8 RTGTTIEIDGAVWRVV-EFLHVKPGKGSAFVRSKLKAVKTGN-VVEKTFRAGE---MLPQ 62 Query: 34 SLLVRS 17 +LL ++ Sbjct: 63 ALLEKA 68
>ASPM_CANFA (P62286) Abnormal spindle-like microcephaly-associated protein| homolog (Fragment) Length = 3452 Score = 30.4 bits (67), Expect = 3.6 Identities = 12/38 (31%), Positives = 24/38 (63%) Frame = -1 Query: 178 HRLVGALLHVRPGEAGLEVRRHLAHLHRADLVVQRTHR 65 ++L +++ ++ G G++ RRHL +H A ++QR R Sbjct: 2229 NKLRHSIIRIQAGFRGMKARRHLKSMHLAATLIQRRFR 2266
>ASPM_SAIBB (P62296) Abnormal spindle-like microcephaly-associated protein| homolog Length = 3469 Score = 30.0 bits (66), Expect = 4.7 Identities = 13/38 (34%), Positives = 25/38 (65%) Frame = -1 Query: 178 HRLVGALLHVRPGEAGLEVRRHLAHLHRADLVVQRTHR 65 ++L +++H++ G++VRRHL +H A ++QR R Sbjct: 2228 NKLRHSVIHIQAIFRGMKVRRHLKTMHIAATLIQRRFR 2265
>KCNH6_RAT (O54853) Potassium voltage-gated channel subfamily H member 6| (Voltage-gated potassium channel subunit Kv11.2) (Ether-a-go-go-related gene potassium channel 2) (Ether-a-go-go-related protein 2) (Eag-related protein 2) Length = 950 Score = 30.0 bits (66), Expect = 4.7 Identities = 19/58 (32%), Positives = 30/58 (51%), Gaps = 12/58 (20%) Frame = -1 Query: 220 LRRAGLDVLLDVAVHRLVG--------ALLHVRPGEAGLEVRR----HLAHLHRADLV 83 + R +++L D V ++G A LH RPG++ +VR L +HRADL+ Sbjct: 634 ISRGSIEILRDDVVVAILGKNDIFGEPASLHARPGKSSADVRALTYCDLHKIHRADLL 691
>EFP_PROMP (Q7V3P5) Elongation factor P (EF-P)| Length = 186 Score = 29.6 bits (65), Expect = 6.1 Identities = 19/55 (34%), Positives = 29/55 (52%) Frame = -1 Query: 214 RAGLDVLLDVAVHRLVGALLHVRPGEAGLEVRRHLAHLHRADLVVQRTHRHGRDL 50 R G + +D V R+V LHV+PG+ VR L + + VV++T R G + Sbjct: 8 RTGTTIEIDGQVWRVV-EFLHVKPGKGSAFVRTKLKSVRNGN-VVEKTFRAGESV 60 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58,333,392 Number of Sequences: 219361 Number of extensions: 999772 Number of successful extensions: 2925 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 2803 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2925 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4643056080 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)