| Clone Name | bags16f19 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ZN142_HUMAN (P52746) Zinc finger protein 142 (HA4654) | 29 | 2.7 | 2 | MK04_MOUSE (Q6P5G0) Mitogen-activated protein kinase 4 (EC 2.7.1... | 28 | 4.6 | 3 | COBD_SALTY (P97084) Threonine-phosphate decarboxylase (EC 4.1.1.... | 28 | 4.6 | 4 | POLS_RUBVM (P08563) Structural polyprotein [Contains: Nucleocaps... | 28 | 7.8 | 5 | TFG_HUMAN (Q92734) Protein TFG (TRK-fused gene protein) | 28 | 7.8 |
|---|
>ZN142_HUMAN (P52746) Zinc finger protein 142 (HA4654)| Length = 1687 Score = 29.3 bits (64), Expect = 2.7 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = +3 Query: 156 DGDENAGRPDLACPYC 203 DGD +AG+P L CP+C Sbjct: 1414 DGDGDAGQPPLHCPFC 1429
>MK04_MOUSE (Q6P5G0) Mitogen-activated protein kinase 4 (EC 2.7.11.24)| (Extracellular signal-regulated kinase 4) (ERK-4) Length = 583 Score = 28.5 bits (62), Expect = 4.6 Identities = 15/36 (41%), Positives = 19/36 (52%), Gaps = 3/36 (8%) Frame = +1 Query: 34 IYLSTPAWTRSTGS---RAWPPPSGSTQRSSATPIG 132 ++L W +ST S RA PPP R SA+P G Sbjct: 485 LFLEIAQWVKSTQSGSERASPPPDAPEPRLSASPPG 520
>COBD_SALTY (P97084) Threonine-phosphate decarboxylase (EC 4.1.1.81)| (L-threonine-O-3-phosphate decarboxylase) Length = 364 Score = 28.5 bits (62), Expect = 4.6 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = -3 Query: 277 GAAWGSKGCSSSRWAIREATSW 212 G A GC RW++REA W Sbjct: 112 GRALAQSGCEIRRWSLREADGW 133
>POLS_RUBVM (P08563) Structural polyprotein [Contains: Nucleocapsid protein C;| Membrane glycoprotein E2; Membrane glycoprotein E1] Length = 992 Score = 27.7 bits (60), Expect = 7.8 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +1 Query: 46 TPAWTRSTGSRAWPPPSGSTQRSSATP 126 T AW R SRA PPP + S TP Sbjct: 65 TGAWQRKDWSRAPPPPEERQESRSQTP 91
>TFG_HUMAN (Q92734) Protein TFG (TRK-fused gene protein)| Length = 400 Score = 27.7 bits (60), Expect = 7.8 Identities = 14/37 (37%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = +1 Query: 37 YLSTPAWTRSTGSRAWPPPSG-STQRSSATPIGRGWT 144 Y P +T GS PPPSG + + P G+G+T Sbjct: 357 YQPRPGFTSLPGSTMTPPPSGPNPYARNRPPFGQGYT 393 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.314 0.131 0.433 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,331,695 Number of Sequences: 219361 Number of extensions: 428684 Number of successful extensions: 1402 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1360 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1402 length of database: 80,573,946 effective HSP length: 73 effective length of database: 64,560,593 effective search space used: 1549454232 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits)