| Clone Name | bags16f07 |
|---|---|
| Clone Library Name | barley_pub |
>HTPX_BIFLO (Q8G6T7) Probable protease htpX homolog (EC 3.4.24.-)| Length = 306 Score = 29.6 bits (65), Expect = 2.0 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 3/51 (5%) Frame = -2 Query: 234 VGHGILHTYSEALVARIHDVLINNVARRRSTGSGYLGHS---DGAHQRDQR 91 +GH ++H Y+ HD+L + +A +T YLG+S G RD R Sbjct: 133 LGHELMHVYN-------HDILTSAIASAMATVISYLGYSLMYFGGGSRDDR 176
>PUT2_EMENI (Q9P8I0) Delta-1-pyrroline-5-carboxylate dehydrogenase,| mitochondrial precursor (EC 1.5.1.12) (P5C dehydrogenase) Length = 572 Score = 27.7 bits (60), Expect = 7.5 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = -2 Query: 258 TDITRNNPVGHGILHTYSEALVARIHDVLINNVARRRSTGS 136 + +T++NP HG + TYS A + + + + R+S S Sbjct: 81 SSLTQSNPASHGPVATYSNATAKDVQAAIESALEARKSWAS 121
>NU5M_PARLI (P12776) NADH-ubiquinone oxidoreductase chain 5 (EC 1.6.5.3) (NADH| dehydrogenase subunit 5) Length = 638 Score = 27.7 bits (60), Expect = 7.5 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -2 Query: 279 TTVNWNLTDITRNNPVGHGIL 217 TT +WNLT+I N P H +L Sbjct: 224 TTNSWNLTEIITNEPNNHFVL 244
>BGAL_ARTSB (Q59140) Beta-galactosidase (EC 3.2.1.23) (Lactase)| Length = 1015 Score = 27.3 bits (59), Expect = 9.9 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +2 Query: 98 SR*CAPSLWPRYPLPVERRRATLLIRTS 181 SR C P +WP + L E R L IR + Sbjct: 988 SRACGPDVWPDFALRPEARTLVLRIRAA 1015
>IRAK2_HUMAN (O43187) Interleukin-1 receptor-associated kinase-like 2 (IRAK-2)| Length = 590 Score = 27.3 bits (59), Expect = 9.9 Identities = 12/41 (29%), Positives = 20/41 (48%), Gaps = 4/41 (9%) Frame = +1 Query: 211 GMQNAMADRI----ISGNVGKVPVDCCVVFGGHSCLCKMKK 321 G++N MA I + G++P DC +CLC ++ Sbjct: 445 GVENVMAKEICQKYLEKGAGRLPEDCAEALATAACLCLRRR 485 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,948,076 Number of Sequences: 219361 Number of extensions: 735517 Number of successful extensions: 2128 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2097 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2127 length of database: 80,573,946 effective HSP length: 82 effective length of database: 62,586,344 effective search space used: 1502072256 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)