| Clone Name | bags16f01 |
|---|---|
| Clone Library Name | barley_pub |
>CTND1_XENLA (Q8AXM9) Catenin delta-1 (p120 catenin) (p120(ctn)) (Xp120(ctn))| Length = 859 Score = 31.2 bits (69), Expect = 0.68 Identities = 15/41 (36%), Positives = 24/41 (58%) Frame = +2 Query: 83 LWVESIDPPLASVSAVRNKELHKNTLYTTVKVQARSVTVEE 205 +WV +PPLA+ S R ++ LYT +++A SV +E Sbjct: 44 VWVTPQEPPLANGSLTRRQQDGLPFLYTPTRMEAHSVHADE 84
>RFP2_HUMAN (O60858) Ret finger protein 2 (Leukemia-associated protein 5)| (B-cell chronic lymphocytic leukemia tumor suppressor Leu5) (Putative tumor suppressor RFP2) (Tripartite motif protein 13) (RING finger protein 77) Length = 407 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/40 (35%), Positives = 23/40 (57%), Gaps = 7/40 (17%) Frame = -2 Query: 328 Y*KFRSSPWLPVCR-------YLECRTELKLVMGVCFTDG 230 Y K + SP +PVC+ + C T+++L+ G+C T G Sbjct: 82 YNKIKISPKMPVCKGHLGQPLNIFCLTDMQLICGICATRG 121
>NADD_ANASP (Q8YM77) Probable nicotinate-nucleotide adenylyltransferase (EC| 2.7.7.18) (Deamido-NAD(+) pyrophosphorylase) (Deamido-NAD(+) diphosphorylase) (Nicotinate mononucleotide adenylyltransferase) (NaMN adenylyltransferase) Length = 208 Score = 29.3 bits (64), Expect = 2.6 Identities = 18/63 (28%), Positives = 27/63 (42%), Gaps = 6/63 (9%) Frame = +2 Query: 83 LWVESIDPPLASVSAVRNK------ELHKNTLYTTVKVQARSVTVEEA*LCIASSSVCKT 244 +WV S++PP SA R++ N +T V+ V A + SVC Sbjct: 35 IWVPSLNPPHKKASAFRHRLAMLQLATQDNPAFTVSSVEKNRSGVSYAINTLTDLSVCFP 94 Query: 245 NSH 253 N+H Sbjct: 95 NTH 97
>NU120_YEAST (P35729) Nucleoporin NUP120 (Nuclear pore protein NUP120)| Length = 1037 Score = 27.7 bits (60), Expect = 7.5 Identities = 16/31 (51%), Positives = 18/31 (58%), Gaps = 3/31 (9%) Frame = -3 Query: 240 LQTELEAMQS---HASSTVTDLACTFTVVYR 157 L T LE ++S H S DL CTFTV YR Sbjct: 790 LPTFLEDLKSENYHGDSIWKDLLCTFTVPYR 820
>MAST3_HUMAN (O60307) Microtubule-associated serine/threonine-protein kinase 3| (EC 2.7.11.1) Length = 1309 Score = 27.7 bits (60), Expect = 7.5 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = +3 Query: 228 VPSVKQTPMTSFSSVLHSRYRHTGSHGDDRN 320 VP ++ TS+ RYRH GS D+ N Sbjct: 656 VPQLEAEDDTSYFDTRSERYRHLGSEDDETN 686 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,125,972 Number of Sequences: 219361 Number of extensions: 650092 Number of successful extensions: 1599 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1584 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1599 length of database: 80,573,946 effective HSP length: 85 effective length of database: 61,928,261 effective search space used: 1486278264 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)