| Clone Name | bags15o01 |
|---|---|
| Clone Library Name | barley_pub |
>HSDR_STAS1 (Q4A127) Type-1 restriction enzyme R protein (EC 3.1.21.3) (Type I| restriction enzyme R protein) Length = 930 Score = 32.7 bits (73), Expect = 0.78 Identities = 20/80 (25%), Positives = 40/80 (50%) Frame = -2 Query: 363 VNINQIISRI*FYRK*IPIFVGVFTQICLFIIIVIIDTHHLSKSQTDFLDNGIIFRRCYS 184 ++IN+ +++ YRK + G+F I LFII IDT ++S + + + + + Sbjct: 144 IDINEAFNQVMRYRK--QNYTGLFRYIQLFIISNGIDTRYISNNDGEIYKSHMFYWSDKE 201 Query: 183 SFKLIIFRESTRAVLKTCFL 124 + ++ E T L+ C + Sbjct: 202 NNRINTLNEFTETFLRPCHI 221
>NU6C_MESVI (Q9MUL3) NAD(P)H-quinone oxidoreductase chain 6, chloroplast (EC| 1.6.5.-) (NAD(P)H dehydrogenase, chain 6) (NADH-plastoquinone oxidoreductase chain 6) Length = 189 Score = 30.4 bits (67), Expect = 3.9 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = -2 Query: 309 IFVGVFTQICLFIIIVIIDTHHLSKSQTDFLDNGIIFRRCYSSFKLI 169 I+VG I LF I+++ +L+ S + NG+ C+S F L+ Sbjct: 65 IYVGAINVIILFAIMLVNKIENLNPSNNQMMRNGLSSFICFSFFILL 111
>PO3F4_RAT (P62516) POU domain, class 3, transcription factor 4| (Brain-specific homeobox/POU domain protein 4) (Brain-4) (Brn-4) (RHS2 class III POU protein) Length = 361 Score = 30.0 bits (66), Expect = 5.0 Identities = 19/57 (33%), Positives = 27/57 (47%), Gaps = 7/57 (12%) Frame = -3 Query: 197 ADAIPASNLSSSGRAQELCSKPAFSQMLRLRHEPLLTPSALQSTKG-------PPIH 48 A P S+++SSG+ + S+P F+ L H L P A ST+ PP H Sbjct: 116 ASPAPNSSITSSGQPLNVYSQPGFTVSGMLEHGGLTPPPAAASTQSLHPVLREPPDH 172
>PO3F4_MOUSE (P62515) POU domain, class 3, transcription factor 4| (Brain-specific homeobox/POU domain protein 4) (Brain-4) (Brn-4) Length = 361 Score = 30.0 bits (66), Expect = 5.0 Identities = 19/57 (33%), Positives = 27/57 (47%), Gaps = 7/57 (12%) Frame = -3 Query: 197 ADAIPASNLSSSGRAQELCSKPAFSQMLRLRHEPLLTPSALQSTKG-------PPIH 48 A P S+++SSG+ + S+P F+ L H L P A ST+ PP H Sbjct: 116 ASPAPNSSITSSGQPLNVYSQPGFTVSGMLEHGGLTPPPAAASTQSLHPVLREPPDH 172
>MEF2B_MOUSE (O55087) Myocyte-specific enhancer factor 2B| Length = 349 Score = 30.0 bits (66), Expect = 5.0 Identities = 18/59 (30%), Positives = 28/59 (47%) Frame = -3 Query: 191 AIPASNLSSSGRAQELCSKPAFSQMLRLRHEPLLTPSALQSTKGPPIHKLNXEVRKELP 15 A P + G + S+PA+ + L H P+ +PS L S PP++ R +LP Sbjct: 149 ATPGCDPGGLGEVPSVHSRPAYFRPPGLGH-PIFSPSHLASKTPPPLYLATDGRRPDLP 206
>CXA7_CHICK (P18861) Gap junction alpha-7 protein (Connexin-45) (Cx45)| Length = 394 Score = 29.6 bits (65), Expect = 6.6 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +3 Query: 471 FCNERKPCKAGNCHKVECFMGPPTYMILLLLLTH 572 F RKPC HK++CF+ PT + LL+ + Sbjct: 208 FVCSRKPCP----HKIDCFISRPTEKTIFLLIMY 237
>FBLN1_CAEEL (O77469) Fibulin-1 precursor| Length = 728 Score = 29.6 bits (65), Expect = 6.6 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +3 Query: 456 DSTVGFCNERKPCKAGNCHKVECFMGPPTY 545 + GFC + C+ G C +EC P TY Sbjct: 382 NGATGFCEDVNECQQGVCGSMECINLPGTY 411 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.317 0.130 0.370 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 74,386,925 Number of Sequences: 219361 Number of extensions: 1344557 Number of successful extensions: 3753 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 3631 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3752 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4986986160 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)