| Clone Name | bags16b18 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ERC2_RAT (Q8K3M6) ERC protein 2 (CAZ-associated structural prote... | 31 | 4.1 | 2 | ERC2_MOUSE (Q6PH08) ERC protein 2 (CAZ-associated structural pro... | 31 | 4.1 | 3 | ERC2_HUMAN (O15083) ERC protein 2 | 31 | 4.1 |
|---|
>ERC2_RAT (Q8K3M6) ERC protein 2 (CAZ-associated structural protein 1)| (CAST1) (Cast) (Cytomatrix protein p110) Length = 957 Score = 30.8 bits (68), Expect = 4.1 Identities = 18/53 (33%), Positives = 30/53 (56%), Gaps = 1/53 (1%) Frame = -2 Query: 419 KELKETRKD*QEHCSQAQ-H*HRVFEICLEATNERRINNEKILELKNYT*RHV 264 K+L + ++ C +AQ R+ EI E NE+ ++KI EL++ T RH+ Sbjct: 706 KQLDKEASYYRDECGKAQAEVDRLLEILKEVENEKNDKDKKIAELESLTLRHM 758
>ERC2_MOUSE (Q6PH08) ERC protein 2 (CAZ-associated structural protein 1)| (CAST1) Length = 957 Score = 30.8 bits (68), Expect = 4.1 Identities = 18/53 (33%), Positives = 30/53 (56%), Gaps = 1/53 (1%) Frame = -2 Query: 419 KELKETRKD*QEHCSQAQ-H*HRVFEICLEATNERRINNEKILELKNYT*RHV 264 K+L + ++ C +AQ R+ EI E NE+ ++KI EL++ T RH+ Sbjct: 706 KQLDKEASYYRDECGKAQAEVDRLLEILKEVENEKNDKDKKIAELESLTLRHM 758
>ERC2_HUMAN (O15083) ERC protein 2| Length = 957 Score = 30.8 bits (68), Expect = 4.1 Identities = 18/53 (33%), Positives = 30/53 (56%), Gaps = 1/53 (1%) Frame = -2 Query: 419 KELKETRKD*QEHCSQAQ-H*HRVFEICLEATNERRINNEKILELKNYT*RHV 264 K+L + ++ C +AQ R+ EI E NE+ ++KI EL++ T RH+ Sbjct: 706 KQLDKEASYYRDECGKAQAEVDRLLEILKEVENEKNDKDKKIAELESLTLRHM 758 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 73,410,479 Number of Sequences: 219361 Number of extensions: 1176404 Number of successful extensions: 2476 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2421 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2475 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6825954960 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)