| Clone Name | bags15l22 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SOS_DROME (P26675) Protein son of sevenless | 31 | 2.3 | 2 | ATM_HUMAN (Q13315) Serine-protein kinase ATM (EC 2.7.11.1) (Atax... | 30 | 4.0 | 3 | NHX4_ARATH (Q8S397) Sodium/hydrogen exchanger 4 (Na(+)/H(+) exch... | 29 | 6.8 | 4 | AMPA_RICTY (Q68XM6) Probable cytosol aminopeptidase (EC 3.4.11.1... | 29 | 8.9 | 5 | AMPA_RICPR (P27888) Cytosol aminopeptidase (EC 3.4.11.1) (Leucin... | 29 | 8.9 |
|---|
>SOS_DROME (P26675) Protein son of sevenless| Length = 1596 Score = 30.8 bits (68), Expect = 2.3 Identities = 19/51 (37%), Positives = 23/51 (45%) Frame = +2 Query: 194 LEKARQSETIKFSLYKNXXXXXXXXXEWKSKRKGVGIPLDESLKKMQHRGN 346 LE ARQ ++F +YKN W K K V P LK M+H N Sbjct: 831 LELARQLTLLEFEMYKNVKPSELVGSPWTKKDKEVKSP--NLLKIMKHTTN 879
>ATM_HUMAN (Q13315) Serine-protein kinase ATM (EC 2.7.11.1) (Ataxia| telangiectasia mutated) (A-T, mutated) Length = 3056 Score = 30.0 bits (66), Expect = 4.0 Identities = 9/22 (40%), Positives = 18/22 (81%) Frame = +2 Query: 272 EWKSKRKGVGIPLDESLKKMQH 337 +WK++RKG+ IP D+ + K+++ Sbjct: 2637 QWKTQRKGINIPADQPITKLKN 2658
>NHX4_ARATH (Q8S397) Sodium/hydrogen exchanger 4 (Na(+)/H(+) exchanger 4)| (NHE-4) Length = 529 Score = 29.3 bits (64), Expect = 6.8 Identities = 23/67 (34%), Positives = 31/67 (46%), Gaps = 1/67 (1%) Frame = -2 Query: 403 FLGETRIF-FVQTKALSLAFVSSVLHLL*RFIQWNPNSLSFGFPFYLDMVYVDLILI*RK 227 F+ ET IF +V T AL F +W +SLSFG + V L+L+ R Sbjct: 308 FIAETFIFLYVGTDALD-------------FTKWKTSSLSFGGTLGVSGVITALVLLGRA 354 Query: 226 LYRFTLS 206 + F LS Sbjct: 355 AFVFPLS 361
>AMPA_RICTY (Q68XM6) Probable cytosol aminopeptidase (EC 3.4.11.1) (Leucine| aminopeptidase) (LAP) (Leucyl aminopeptidase) Length = 500 Score = 28.9 bits (63), Expect = 8.9 Identities = 14/35 (40%), Positives = 22/35 (62%) Frame = +1 Query: 406 EEKFWIN*QC*IELTNLSSAYSTLMGSTLCFCFTN 510 +EKF N +C I++ L+ A + +GST CF+N Sbjct: 362 QEKF--NPKCVIDVATLTGAITVALGSTYAGCFSN 394
>AMPA_RICPR (P27888) Cytosol aminopeptidase (EC 3.4.11.1) (Leucine| aminopeptidase) (LAP) (Leucyl aminopeptidase) Length = 500 Score = 28.9 bits (63), Expect = 8.9 Identities = 14/35 (40%), Positives = 22/35 (62%) Frame = +1 Query: 406 EEKFWIN*QC*IELTNLSSAYSTLMGSTLCFCFTN 510 +EKF N +C I++ L+ A + +GST CF+N Sbjct: 362 QEKF--NPKCVIDVATLTGAITVALGSTYAGCFSN 394 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,254,025 Number of Sequences: 219361 Number of extensions: 851251 Number of successful extensions: 1413 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1404 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1413 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3927707336 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)