| Clone Name | bags15i23 |
|---|---|
| Clone Library Name | barley_pub |
>CY1_PARDE (P13627) Cytochrome c1 precursor| Length = 450 Score = 28.9 bits (63), Expect = 3.7 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +2 Query: 134 PSTATEDPAKAETESSPDSSVLSEAIAEEA 223 P A E+PA E E++ + + EA AEEA Sbjct: 155 PEAAAEEPAAEEPEATEEEAPAEEAAAEEA 184
>HUCE1_RAT (Q5U4F0) Cerebral protein 1 homolog| Length = 457 Score = 28.5 bits (62), Expect = 4.9 Identities = 22/65 (33%), Positives = 30/65 (46%), Gaps = 5/65 (7%) Frame = +2 Query: 14 HLQGSPLFEIFLVRDEDETYTMKVVHLRPTKGXXXXXXXV----PSTATEDPAKAETES- 178 H Q PL I ++ + + +L PT+ V STAT DP K+ ES Sbjct: 117 HRQAPPLGGISAGEEKGKRKCQEYSYLHPTQSLNSVDQTVHNSRTSTATLDPPKSSRESA 176 Query: 179 SPDSS 193 SP+SS Sbjct: 177 SPNSS 181
>BAZ1B_HUMAN (Q9UIG0) Bromodomain adjacent to zinc finger domain protein 1B| (Williams-Beuren syndrome chromosome region 9 protein) (WBRS9) (Williams syndrome transcription factor) (hWALP2) Length = 1483 Score = 28.1 bits (61), Expect = 6.4 Identities = 18/56 (32%), Positives = 26/56 (46%), Gaps = 1/56 (1%) Frame = +3 Query: 57 TKTRRTQ*RWYTCDRQKELQARRRPCHQQP-PKIQLRQRLRVHRTAVFYLKPLQRK 221 T ++ Q W+ CD QKEL H Q + QL++RL + + L RK Sbjct: 982 TTPKQGQNLWFLCDSQKELDELLNCLHPQGIRESQLKERLEKRYQDIIHSIHLARK 1037
>HIS6_VIBCH (Q9KSW8) Imidazole glycerol phosphate synthase subunit hisF (EC| 4.1.3.-) (IGP synthase cyclase subunit) (IGP synthase subunit hisF) (ImGP synthase subunit hisF) (IGPS subunit hisF) Length = 257 Score = 27.7 bits (60), Expect = 8.3 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +3 Query: 39 KYSSSETKTRRTQ*RWYTCDRQKELQAR 122 +++ E++TR TQ W TCD +E+Q R Sbjct: 144 QFTGDESRTRATQ--WQTCDWVQEVQKR 169
>NAR1_RABIT (Q03515) GPI-linked NAD(P)(+)--arginine ADP-ribosyltransferase 1| precursor (EC 2.4.2.31) (Mono(ADP-ribosyl)transferase) Length = 327 Score = 27.7 bits (60), Expect = 8.3 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +3 Query: 87 YTCDRQKELQARRRPCH 137 Y C+ KE+Q + RPCH Sbjct: 275 YNCEYIKEMQCKSRPCH 291
>EXEC1_ARATH (Q93YW0) EXECUTER1 protein, chloroplast precursor| Length = 684 Score = 27.7 bits (60), Expect = 8.3 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +2 Query: 23 GSPLFEIFLVRDEDETYTMKVVHLR 97 G+PLFEIFL D Y + V+L+ Sbjct: 239 GAPLFEIFLTLDGKGNYKKQAVYLK 263 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,119,961 Number of Sequences: 219361 Number of extensions: 399535 Number of successful extensions: 1096 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1069 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1096 length of database: 80,573,946 effective HSP length: 52 effective length of database: 69,167,174 effective search space used: 1660012176 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)