| Clone Name | bags15h13 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ZSWM5_MOUSE (Q80TC6) Zinc finger SWIM domain-containing protein 5 | 31 | 3.8 | 2 | CP8B1_RABIT (O02766) Cytochrome P450 8B1 (EC 1.14.13.95) (CYPVII... | 30 | 8.5 | 3 | NFT1_CAEEL (O76463) Nitrilase and fragile histidine triad fusion... | 30 | 8.5 |
|---|
>ZSWM5_MOUSE (Q80TC6) Zinc finger SWIM domain-containing protein 5| Length = 1188 Score = 30.8 bits (68), Expect = 3.8 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = -2 Query: 232 RK*LLSPPPFSKRKRTSSWPT 170 R+ LLSPPP S KR SWP+ Sbjct: 7 REELLSPPPISPAKRLCSWPS 27
>CP8B1_RABIT (O02766) Cytochrome P450 8B1 (EC 1.14.13.95) (CYPVIIIB1)| (7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase) (Sterol 12-alpha-hydroxylase) (7-alpha-hydroxy-4-cholesten-3-one 12-alpha-hydroxylase) Length = 499 Score = 29.6 bits (65), Expect = 8.5 Identities = 16/39 (41%), Positives = 20/39 (51%) Frame = +3 Query: 105 PTEFRVDRVLQPFDSAKFNFTKVGQEEVLFRFENGGGDS 221 PT F+ DR L P S K +F K GQ+ + G G S Sbjct: 398 PTTFKYDRFLNPNGSRKVDFYKAGQKIHHYTMPWGSGVS 436
>NFT1_CAEEL (O76463) Nitrilase and fragile histidine triad fusion protein| NitFhit [Includes: Bis(5'-adenosyl)-triphosphatase (EC 3.6.1.29) (Diadenosine 5',5'''-P1,P3-triphosphate hydrolase) (Dinucleosidetriphosphatase) (AP3A hydrolase) (AP3Aase); Nitrilas Length = 440 Score = 29.6 bits (65), Expect = 8.5 Identities = 21/57 (36%), Positives = 28/57 (49%), Gaps = 1/57 (1%) Frame = +3 Query: 201 ENGGGDSSYFLENAPSIEGDRAPSVVAINVSPIEYGHVLLIP-RVLDRLPQQIDPES 368 E GG + F A I S V +N+ P+ GHVL+ P RV+ RL D E+ Sbjct: 295 ETGGLKFARFNIPADHIFYSTPHSFVFVNLKPVTDGHVLVSPKRVVPRLTDLTDAET 351 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 99,606,956 Number of Sequences: 219361 Number of extensions: 2195584 Number of successful extensions: 5730 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5458 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5712 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6427774254 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)