| Clone Name | rbaal9n07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | NUDH_BORPE (Q7VTZ7) Probable (di)nucleoside polyphosphate hydrol... | 29 | 2.9 | 2 | NUDH_BORPA (Q7W482) Probable (di)nucleoside polyphosphate hydrol... | 29 | 2.9 | 3 | NUDH_BORBR (Q7WFP0) Probable (di)nucleoside polyphosphate hydrol... | 29 | 2.9 |
|---|
>NUDH_BORPE (Q7VTZ7) Probable (di)nucleoside polyphosphate hydrolase (EC| 3.6.1.-) Length = 190 Score = 29.3 bits (64), Expect = 2.9 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 5/39 (12%) Frame = +3 Query: 33 ESPLQC----LHQETGAD-QRSRVLGTAADKLKYTLTDH 134 ESP+Q LH+E G + R+LG D L+Y + DH Sbjct: 44 ESPVQAMYRELHEEVGLKPEHVRILGRTRDWLRYNVPDH 82
>NUDH_BORPA (Q7W482) Probable (di)nucleoside polyphosphate hydrolase (EC| 3.6.1.-) Length = 190 Score = 29.3 bits (64), Expect = 2.9 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 5/39 (12%) Frame = +3 Query: 33 ESPLQC----LHQETGAD-QRSRVLGTAADKLKYTLTDH 134 ESP+Q LH+E G + R+LG D L+Y + DH Sbjct: 44 ESPVQAMYRELHEEVGLKPEHVRILGRTRDWLRYNVPDH 82
>NUDH_BORBR (Q7WFP0) Probable (di)nucleoside polyphosphate hydrolase (EC| 3.6.1.-) Length = 190 Score = 29.3 bits (64), Expect = 2.9 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 5/39 (12%) Frame = +3 Query: 33 ESPLQC----LHQETGAD-QRSRVLGTAADKLKYTLTDH 134 ESP+Q LH+E G + R+LG D L+Y + DH Sbjct: 44 ESPVQAMYRELHEEVGLKPEHVRILGRTRDWLRYNVPDH 82 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,831,043 Number of Sequences: 219361 Number of extensions: 493314 Number of successful extensions: 1085 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1077 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1085 length of database: 80,573,946 effective HSP length: 53 effective length of database: 68,947,813 effective search space used: 1654747512 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)