| Clone Name | bags15g15 |
|---|---|
| Clone Library Name | barley_pub |
>IBB_HORVU (P12940) Bowman-Birk type trypsin inhibitor| Length = 124 Score = 89.7 bits (221), Expect = 2e-18 Identities = 35/60 (58%), Positives = 44/60 (73%) Frame = +3 Query: 189 RPWKCCDFXVCYRALPRACRCLDEVEQCAPTCKSCQPAPSDPSRHVCNDRYTGDIGPTCT 368 RPW+CCD +C R+ P CRC+DEV++CAPTCK+C P+ S PSR VC D Y G + P CT Sbjct: 63 RPWECCDKAICTRSNPPTCRCVDEVKKCAPTCKTCLPSRSRPSRRVCIDSYFGPVPPRCT 122 Score = 87.8 bits (216), Expect = 6e-18 Identities = 35/61 (57%), Positives = 43/61 (70%) Frame = +3 Query: 183 EERPWKCCDFXVCYRALPRACRCLDEVEQCAPTCKSCQPAPSDPSRHVCNDRYTGDIGPT 362 ++RPWKCCD VC R++P C C+DEV +C TCKSC P DPSR +C D+Y GD GP Sbjct: 3 KKRPWKCCDEAVCTRSIPPICTCMDEVFECPKTCKSCGPM-GDPSRRICQDQYVGDPGPI 61 Query: 363 C 365 C Sbjct: 62 C 62
>IBB1_COILA (P07679) Bowman-Birk type trypsin inhibitor TI1| Length = 64 Score = 88.2 bits (217), Expect = 4e-18 Identities = 33/63 (52%), Positives = 47/63 (74%) Frame = +3 Query: 177 GDEERPWKCCDFXVCYRALPRACRCLDEVEQCAPTCKSCQPAPSDPSRHVCNDRYTGDIG 356 GDE+RPW+CCD +C R++P CRC+D+V++C+ CK C+ ++ +RHVC D Y GD G Sbjct: 1 GDEKRPWECCDIAMCTRSIPPICRCVDKVDRCSDACKDCE--ETEDNRHVCFDTYIGDPG 58 Query: 357 PTC 365 PTC Sbjct: 59 PTC 61
>IBB2_WHEAT (P09864) Bowman-Birk type proteinase inhibitor II-4 (Fragment)| Length = 53 Score = 81.6 bits (200), Expect = 4e-16 Identities = 32/51 (62%), Positives = 36/51 (70%) Frame = +3 Query: 189 RPWKCCDFXVCYRALPRACRCLDEVEQCAPTCKSCQPAPSDPSRHVCNDRY 341 RPWKCCD +C ++ P CRC+D VEQCA TCK C PA SD SR VC D Y Sbjct: 3 RPWKCCDRAICTKSFPPMCRCMDMVEQCAATCKKCGPATSDSSRRVCEDXY 53
>IBB1_WHEAT (P09863) Bowman-Birk type proteinase inhibitor I-2B (Fragment)| Length = 56 Score = 81.3 bits (199), Expect = 5e-16 Identities = 30/53 (56%), Positives = 40/53 (75%) Frame = +3 Query: 183 EERPWKCCDFXVCYRALPRACRCLDEVEQCAPTCKSCQPAPSDPSRHVCNDRY 341 ++RPWKCCD VC R++P CRC+D+V +C TCK+C P+ DPSR VC D+Y Sbjct: 3 KKRPWKCCDQAVCTRSIPPICRCMDQVFECPSTCKACGPSVGDPSRRVCQDQY 55
>IBB3_SETIT (P22737) Bowman-Birk type trypsin inhibitor 3 (Bowman-Birk type| trypsin inhibitor III) (FMTI-III) Length = 67 Score = 76.3 bits (186), Expect = 2e-14 Identities = 31/63 (49%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = +3 Query: 186 ERPWKCCDFXVCYRALPRACRCLDEVEQCAPTCKSC-QPAPSDPSRHVCNDRYTGDIGPT 362 ERPWKCCD C +++P CRC D +EQC+ CK C + SDP R++C D Y G P Sbjct: 3 ERPWKCCDLQTCTKSIPAFCRCRDLLEQCSDACKECGKVRDSDPPRYICQDVYRGIPAPM 62 Query: 363 CTE 371 C E Sbjct: 63 CHE 65
>IBB2_SETIT (P19860) Bowman-Birk type major trypsin inhibitor (FMTI-II)| Length = 67 Score = 76.3 bits (186), Expect = 2e-14 Identities = 31/63 (49%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = +3 Query: 186 ERPWKCCDFXVCYRALPRACRCLDEVEQCAPTCKSC-QPAPSDPSRHVCNDRYTGDIGPT 362 ERPWKCCD C +++P CRC D +EQC+ CK C + SDP R++C D Y G P Sbjct: 3 ERPWKCCDLQTCTKSIPAFCRCRDLLEQCSDACKECGKVRDSDPPRYICQDVYRGIPAPM 62 Query: 363 CTE 371 C E Sbjct: 63 CHE 65
>IBBR_ORYSA (P07084) Bowman-Birk type bran trypsin inhibitor precursor (RBTI)| (OSE727A) Length = 195 Score = 72.0 bits (175), Expect = 3e-13 Identities = 31/61 (50%), Positives = 38/61 (62%), Gaps = 2/61 (3%) Frame = +3 Query: 189 RPW-KCCDFXVCYRALPRACRCLDEVEQCAPTCKSCQPA-PSDPSRHVCNDRYTGDIGPT 362 R W CCD C + P CRC+DEV++CA CK CQ S+P R+VC DR+TG GP Sbjct: 129 RTWGDCCDKAFCNKMNPPTCRCMDEVKECADACKDCQRVESSEPPRYVCKDRFTGHPGPV 188 Query: 363 C 365 C Sbjct: 189 C 189 Score = 56.6 bits (135), Expect = 1e-08 Identities = 31/67 (46%), Positives = 38/67 (56%), Gaps = 6/67 (8%) Frame = +3 Query: 186 ERPWKCCDFX--VCYRALPRACRCLDEVE--QCAPTCKSCQPAPSD-PSRHVCNDRYTG- 347 E+PWKCCD + + P RC DE+E QC CKSC+ AP P + +C D Y G Sbjct: 61 EKPWKCCDNIERLPTKTNPPQWRCNDELEPSQCTAACKSCREAPGPFPGKLICEDIYWGA 120 Query: 348 DIGPTCT 368 D GP CT Sbjct: 121 DPGPFCT 127 Score = 42.7 bits (99), Expect = 2e-04 Identities = 23/49 (46%), Positives = 27/49 (55%), Gaps = 4/49 (8%) Frame = +3 Query: 234 PRACRCLDEVEQCAPTCKSCQPAPS---DPSRHVCNDRY-TGDIGPTCT 368 P RC DEV+QCA CK C AP + VC+D + T D GP CT Sbjct: 4 PPLYRCNDEVKQCAAACKECVEAPGGDFNGGAFVCSDWFSTVDPGPKCT 52
>IBB_MEDSC (P80321) Bowman-Birk type proteinase inhibitor (MSTI)| Length = 62 Score = 48.1 bits (113), Expect = 5e-06 Identities = 23/56 (41%), Positives = 30/56 (53%) Frame = +3 Query: 201 CCDFXVCYRALPRACRCLDEVEQCAPTCKSCQPAPSDPSRHVCNDRYTGDIGPTCT 368 CCDF C R++P C+C D E+C CKSC S P + C D T P+C+ Sbjct: 8 CCDFCPCTRSIPPQCQCTDVREKCHSACKSCLCTRSFPPQCRCYD-ITDFCYPSCS 62 Score = 32.3 bits (72), Expect = 0.29 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +3 Query: 186 ERPWKCCDFXVCYRALPRACRCLDEVEQCAPTC 284 E+ C +C R+ P CRC D + C P+C Sbjct: 29 EKCHSACKSCLCTRSFPPQCRCYDITDFCYPSC 61
>IBB_LENCU (Q8W4Y8) Bowman-Birk type proteinase inhibitor precursor| (Trypsin/chymotrypsin inhibitor) Length = 110 Score = 45.8 bits (107), Expect = 3e-05 Identities = 19/47 (40%), Positives = 25/47 (53%) Frame = +3 Query: 201 CCDFXVCYRALPRACRCLDEVEQCAPTCKSCQPAPSDPSRHVCNDRY 341 CCD +C R+ P CRC+D E C C C A S+P + C D + Sbjct: 50 CCDTCLCTRSQPPTCRCVDVRESCHSACDKCVCAYSNPPQCQCYDTH 96
>IBB_PHALU (P01056) Bowman-Birk type proteinase inhibitor| Length = 83 Score = 45.1 bits (105), Expect = 4e-05 Identities = 17/46 (36%), Positives = 27/46 (58%), Gaps = 1/46 (2%) Frame = +3 Query: 201 CCDFXVCYRALPRACRCLD-EVEQCAPTCKSCQPAPSDPSRHVCND 335 CC+ C +++P CRC D ++ C CKSC S P++ VC++ Sbjct: 18 CCBHCACTKSIPPQCRCTDLRLDSCHSACKSCICTLSIPAQCVCBB 63
>IBBWT_MEDSA (P16346) Bowman-Birk type wound-induced trypsin inhibitor| Length = 58 Score = 45.1 bits (105), Expect = 4e-05 Identities = 19/45 (42%), Positives = 24/45 (53%) Frame = +3 Query: 201 CCDFXVCYRALPRACRCLDEVEQCAPTCKSCQPAPSDPSRHVCND 335 CC+F C R++P CRC D E C CK+C S P + C D Sbjct: 4 CCNFCPCTRSIPPQCRCTDIGETCHSACKTCLCTKSIPPQCHCAD 48 Score = 27.7 bits (60), Expect = 7.1 Identities = 9/27 (33%), Positives = 13/27 (48%) Frame = +3 Query: 204 CDFXVCYRALPRACRCLDEVEQCAPTC 284 C +C +++P C C D C P C Sbjct: 31 CKTCLCTKSIPPQCHCADITNFCYPKC 57
>IBBA_PEA (Q41065) Seed trypsin/chymotrypsin inhibitor IVA precursor (PSTI| IVA) (TI12-36) [Contains: Seed trypsin/chymotrypsin inhibitor I (PSTI I)] (Fragment) Length = 96 Score = 45.1 bits (105), Expect = 4e-05 Identities = 19/47 (40%), Positives = 26/47 (55%) Frame = +3 Query: 201 CCDFXVCYRALPRACRCLDEVEQCAPTCKSCQPAPSDPSRHVCNDRY 341 CCD +C ++ P CRC+D E C C SC A S+P + C D + Sbjct: 32 CCDTCLCTKSNPPTCRCVDVRETCHSACDSCICAYSNPPKCQCFDTH 78
>IBB_VICFA (P24661) Bowman-Birk type proteinase inhibitor (FBI)| Length = 63 Score = 44.7 bits (104), Expect = 6e-05 Identities = 18/47 (38%), Positives = 26/47 (55%) Frame = +3 Query: 201 CCDFXVCYRALPRACRCLDEVEQCAPTCKSCQPAPSDPSRHVCNDRY 341 CCD +C ++ P CRC+D E+C C SC S+P + C D + Sbjct: 8 CCDTCLCTKSEPPTCRCVDVGERCHSACNSCVCRYSNPPKCQCFDTH 54
>IBBB_PEA (P56679) Seed trypsin/chymotrypsin inhibitor IVB (PSTI-IVB)| [Contains: Seed trypsin/chymotrypsin inhibitor II (PSTI II)] Length = 72 Score = 44.3 bits (103), Expect = 7e-05 Identities = 19/45 (42%), Positives = 25/45 (55%) Frame = +3 Query: 201 CCDFXVCYRALPRACRCLDEVEQCAPTCKSCQPAPSDPSRHVCND 335 CCD +C ++ P CRC+D E C C SC A S+P + C D Sbjct: 8 CCDTCLCTKSNPPTCRCVDVGETCHSACLSCICAYSNPPKCQCFD 52
>IBBD2_SOYBN (P01064) Bowman-Birk type proteinase inhibitor D-II precursor (IV)| Length = 83 Score = 43.9 bits (102), Expect = 1e-04 Identities = 20/53 (37%), Positives = 26/53 (49%), Gaps = 1/53 (1%) Frame = +3 Query: 180 DEERPWKCCDFXVCYRALPRACRCLD-EVEQCAPTCKSCQPAPSDPSRHVCND 335 D+E CCD +C R++P C C D + C CKSC S P + C D Sbjct: 17 DDEYSKPCCDLCMCTRSMPPQCSCEDIRLNSCHSDCKSCMCTRSQPGQCRCLD 69 Score = 32.0 bits (71), Expect = 0.38 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +3 Query: 204 CDFXVCYRALPRACRCLDEVEQCAPTCKS 290 C +C R+ P CRCLD + C CKS Sbjct: 52 CKSCMCTRSQPGQCRCLDTNDFCYKPCKS 80
>IBB_VICAN (P01065) Bowman-Birk type proteinase inhibitor (VAI)| Length = 72 Score = 43.5 bits (101), Expect = 1e-04 Identities = 18/47 (38%), Positives = 25/47 (53%) Frame = +3 Query: 201 CCDFXVCYRALPRACRCLDEVEQCAPTCKSCQPAPSDPSRHVCNDRY 341 CCD +C R+ P CRC+D E+C C C S+P + C D + Sbjct: 8 CCDTCLCTRSQPPTCRCVDVGERCHSACNHCVCNYSNPPQCQCFDTH 54 Score = 28.1 bits (61), Expect = 5.4 Identities = 12/37 (32%), Positives = 17/37 (45%) Frame = +3 Query: 186 ERPWKCCDFXVCYRALPRACRCLDEVEQCAPTCKSCQ 296 ER C+ VC + P C+C D + C C S + Sbjct: 29 ERCHSACNHCVCNYSNPPQCQCFDTHKFCYKACHSSE 65
>IBB4_DOLAX (P01059) Bowman-Birk type proteinase inhibitor DE-4| Length = 76 Score = 42.7 bits (99), Expect = 2e-04 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Frame = +3 Query: 201 CCDFXVCYRALPRACRCLD-EVEQCAPTCKSCQPAPSDPSRHVCND 335 CCD C +++P C C D + C CKSC A S+P++ C D Sbjct: 15 CCDLCTCTKSIPPQCHCNDMRLNSCHSACKSCICALSEPAQCFCVD 60
>IBB2_PEA (Q41066) Seed trypsin/chymotrypsin inhibitor TI5-72 precursor| Length = 114 Score = 42.7 bits (99), Expect = 2e-04 Identities = 19/47 (40%), Positives = 25/47 (53%) Frame = +3 Query: 201 CCDFXVCYRALPRACRCLDEVEQCAPTCKSCQPAPSDPSRHVCNDRY 341 CCD +C ++ P CRC+D E C C SC A S P + C D + Sbjct: 50 CCDTCLCTKSDPPTCRCVDVGETCHSACDSCICALSYPPQCQCFDTH 96
>IBB1_SOYBN (P01055) Bowman-Birk type proteinase inhibitor precursor (BBI)| Length = 110 Score = 42.7 bits (99), Expect = 2e-04 Identities = 21/53 (39%), Positives = 27/53 (50%), Gaps = 1/53 (1%) Frame = +3 Query: 180 DEERPWKCCDFXVCYRALPRACRCLD-EVEQCAPTCKSCQPAPSDPSRHVCND 335 D+E CCD C ++ P CRC D + C CKSC A S P++ C D Sbjct: 40 DDESSKPCCDQCACTKSNPPQCRCSDMRLNSCHSACKSCICALSYPAQCFCVD 92
>IBB2_PHAAN (P01061) Bowman-Birk type proteinase inhibitors I-A, I-B, and I-A'| Length = 78 Score = 42.4 bits (98), Expect = 3e-04 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 1/48 (2%) Frame = +3 Query: 201 CCDFXVCYRALPRACRCLD-EVEQCAPTCKSCQPAPSDPSRHVCNDRY 341 CCD +C +++P C+C D ++ C CKSC S P + C D + Sbjct: 18 CCDLCLCTKSIPPQCQCADIRLDSCHSACKSCMCTRSMPGQCRCLDTH 65 Score = 33.5 bits (75), Expect = 0.13 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +3 Query: 204 CDFXVCYRALPRACRCLDEVEQCAPTCKS 290 C +C R++P CRCLD + C CKS Sbjct: 46 CKSCMCTRSMPGQCRCLDTHDFCHKPCKS 74
>IBB1_PHAAN (P01058) Bowman-Birk type proteinase inhibitor| Length = 82 Score = 42.0 bits (97), Expect = 4e-04 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Frame = +3 Query: 201 CCDFXVCYRALPRACRCLD-EVEQCAPTCKSCQPAPSDPSRHVCND 335 CCD C +++P CRC D + C CKSC S P++ C D Sbjct: 18 CCDQCSCTKSMPPKCRCSDIRLNSCHSACKSCACTYSIPAKCFCTD 63
>IBB_DOLBI (Q9S9E3) Horsegram inhibitor 1 (Horsegram inhibitor I) (Bowman-Birk| type proteinase inhibitor HGI-I) [Contains: Horsegram germinated inhibitor 1 (Horsegram germinated inhibitor I) (HGGI-I); Horsegram germinated inhibitor 2 (Horsegram germinated Length = 76 Score = 40.8 bits (94), Expect = 8e-04 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Frame = +3 Query: 201 CCDFXVCYRALPRACRCLD-EVEQCAPTCKSCQPAPSDPSRHVCND 335 CCD C +++P CRC D + C C SC S P++ VC D Sbjct: 16 CCDQCTCTKSIPPQCRCTDVRLNSCHSACSSCVCTFSIPAQCVCVD 61 Score = 28.1 bits (61), Expect = 5.4 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +3 Query: 204 CDFXVCYRALPRACRCLDEVEQCAPTCKS 290 C VC ++P C C+D + C CKS Sbjct: 44 CSSCVCTFSIPAQCVCVDMKDFCYAPCKS 72
>IBB3_DOLAX (P01057) Bowman-Birk type proteinase inhibitor DE-3| Length = 76 Score = 40.8 bits (94), Expect = 8e-04 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Frame = +3 Query: 201 CCDFXVCYRALPRACRCLD-EVEQCAPTCKSCQPAPSDPSRHVCND 335 CCD C +++P CRC D + C C SC S P++ VC D Sbjct: 16 CCDECACTKSIPPQCRCTDVRLNSCHSACSSCVCTFSIPAQCVCVD 61 Score = 28.1 bits (61), Expect = 5.4 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +3 Query: 204 CDFXVCYRALPRACRCLDEVEQCAPTCKS 290 C VC ++P C C+D + C CKS Sbjct: 44 CSSCVCTFSIPAQCVCVDMKDFCYAPCKS 72
>IBB_ERYVA (P81705) Bowman-Birk type proteinase inhibitor (EBI)| Length = 61 Score = 40.4 bits (93), Expect = 0.001 Identities = 19/48 (39%), Positives = 25/48 (52%) Frame = +3 Query: 201 CCDFXVCYRALPRACRCLDEVEQCAPTCKSCQPAPSDPSRHVCNDRYT 344 CCD C ++ P C+C D E C CK C A S P++ C D+ T Sbjct: 4 CCDKCFCTKSNPPICQCRDVGETCHSACKFCICALSYPAQCHCLDQNT 51 Score = 29.6 bits (65), Expect = 1.9 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = +3 Query: 204 CDFXVCYRALPRACRCLDEVEQCAPTCKS 290 C F +C + P C CLD+ C C S Sbjct: 31 CKFCICALSYPAQCHCLDQNTFCYDKCDS 59
>IBB4_PHAVU (P81483) Bowman-Birk type proteinase inhibitor PVI-4| Length = 85 Score = 40.0 bits (92), Expect = 0.001 Identities = 15/46 (32%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Frame = +3 Query: 201 CCDFXVCYRALPRACRCLD-EVEQCAPTCKSCQPAPSDPSRHVCND 335 CC+ C +++P CRC + + C CK C S P++ +C D Sbjct: 22 CCBHCACTKSIPPQCRCSBLRLNSCHSECKGCICTFSIPAQCICTD 67
>IBB3_PHAVU (P81484) Bowman-Birk type proteinase inhibitor PVI-3(2)| Length = 85 Score = 40.0 bits (92), Expect = 0.001 Identities = 15/46 (32%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Frame = +3 Query: 201 CCDFXVCYRALPRACRCLD-EVEQCAPTCKSCQPAPSDPSRHVCND 335 CC+ C +++P CRC + + C CK C S P++ +C D Sbjct: 21 CCBHCACTKSIPPQCRCSBLRLNSCHSECKGCICTFSIPAQCICTD 66
>IBB2_PHAVU (P01060) Bowman-Birk type proteinase inhibitor 2 (Bowman-Birk type| proteinase inhibitor II) Length = 79 Score = 38.1 bits (87), Expect = 0.005 Identities = 15/46 (32%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = +3 Query: 201 CCDFXVCYRALPRACRCLD-EVEQCAPTCKSCQPAPSDPSRHVCND 335 CC+ VC ++P C C + ++ C CKSC S P + C + Sbjct: 17 CCBICVCTASIPPQCVCTBIRLBSCHSACKSCMCTRSMPGKCRCLB 62 Score = 35.0 bits (79), Expect = 0.044 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +3 Query: 204 CDFXVCYRALPRACRCLDEVEQCAPTCKS 290 C +C R++P CRCL+ + C +CKS Sbjct: 45 CKSCMCTRSMPGKCRCLBTTBYCYKSCKS 73
>IBB1_AMBAC (P83284) Bowman-birk type proteinase inhibitor (TaTI)| Length = 63 Score = 38.1 bits (87), Expect = 0.005 Identities = 16/46 (34%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = +3 Query: 201 CCDFXVCYRALPRACRCLD-EVEQCAPTCKSCQPAPSDPSRHVCND 335 CCD C +++P C C D + C C+SC S P++ C D Sbjct: 7 CCDRCACTKSIPPQCHCADIRLNSCHSACESCACTRSIPAKCRCFD 52 Score = 30.0 bits (66), Expect = 1.4 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +3 Query: 204 CDFXVCYRALPRACRCLDEVEQCAPTC 284 C+ C R++P CRC D + C C Sbjct: 35 CESCACTRSIPAKCRCFDITDFCYKPC 61
>IBBC2_SOYBN (P01063) Bowman-Birk type proteinase inhibitor C-II precursor| Length = 83 Score = 37.7 bits (86), Expect = 0.007 Identities = 17/53 (32%), Positives = 23/53 (43%), Gaps = 1/53 (1%) Frame = +3 Query: 180 DEERPWKCCDFXVCYRALPRACRCLD-EVEQCAPTCKSCQPAPSDPSRHVCND 335 D+E CCD +C ++P C C D + C C C S P + C D Sbjct: 14 DDESSKPCCDLCMCTASMPPQCHCADIRLNSCHSACDRCACTRSMPGQCRCLD 66 Score = 36.6 bits (83), Expect = 0.015 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = +3 Query: 204 CDFXVCYRALPRACRCLDEVEQCAPTCKS 290 CD C R++P CRCLD + C CKS Sbjct: 49 CDRCACTRSMPGQCRCLDTTDFCYKPCKS 77
>IBB2_AMBCE (P83283) Bowman-birk type proteinase inhibitor 2 (TcTI2)| Length = 63 Score = 37.7 bits (86), Expect = 0.007 Identities = 16/46 (34%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = +3 Query: 201 CCDFXVCYRALPRACRCLD-EVEQCAPTCKSCQPAPSDPSRHVCND 335 CCD C +++P C C D + C C+SC S P++ C D Sbjct: 7 CCDRCACTKSIPPQCHCADIRLNSCHSACESCACTHSIPAQCRCFD 52 Score = 28.1 bits (61), Expect = 5.4 Identities = 9/27 (33%), Positives = 13/27 (48%) Frame = +3 Query: 204 CDFXVCYRALPRACRCLDEVEQCAPTC 284 C+ C ++P CRC D + C C Sbjct: 35 CESCACTHSIPAQCRCFDITDFCYKPC 61
>IBB1_ARAHY (P01066) Bowman-Birk type proteinase inhibitor A-II [Contains:| Bowman-Birk type proteinase inhibitor A-I; Bowman-Birk type proteinase inhibitor B-I; Bowman-Birk type proteinase inhibitor B-III] Length = 70 Score = 37.7 bits (86), Expect = 0.007 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 2/51 (3%) Frame = +3 Query: 201 CCDFXVCYRALPR--ACRCLDEVEQCAPTCKSCQPAPSDPSRHVCNDRYTG 347 CC+ +C R P C C+D + C +C SC S+P + C D+ G Sbjct: 11 CCNGCLCDRRAPPYFECVCVDTFDHCPASCNSCVCTRSNPPQCRCTDKTQG 61 Score = 27.3 bits (59), Expect = 9.3 Identities = 12/31 (38%), Positives = 17/31 (54%), Gaps = 2/31 (6%) Frame = +3 Query: 204 CDFXVCYRALPRACRCLDEVEQCAPT--CKS 290 C+ VC R+ P CRC D+ + P C+S Sbjct: 40 CNSCVCTRSNPPQCRCTDKTQGRCPVTECRS 70
>IBB4_LONCA (P16343) Bowman-Birk type proteinase inhibitor DE-4 (DE4)| Length = 80 Score = 36.6 bits (83), Expect = 0.015 Identities = 19/52 (36%), Positives = 22/52 (42%), Gaps = 1/52 (1%) Frame = +3 Query: 183 EERPWKCCDFXVCYRALPRACRCLD-EVEQCAPTCKSCQPAPSDPSRHVCND 335 E K C C R+ P C+C D + C CKSC SDP C D Sbjct: 11 ESESSKPCCSSCCTRSRPPQCQCTDVRLNSCHSACKSCMCTFSDPGMCSCLD 62
>IBB3_WHEAT (P81713) Bowman-Birk type trypsin inhibitor (WTI)| Length = 71 Score = 36.6 bits (83), Expect = 0.015 Identities = 15/35 (42%), Positives = 18/35 (51%), Gaps = 2/35 (5%) Frame = +3 Query: 195 WKCCD-FXVCYRALPRACRCLD-EVEQCAPTCKSC 293 W CCD C R +P C C+D C P CK+C Sbjct: 8 WPCCDECGTCTRMIPPRCTCMDVSPSGCHPACKNC 42
>IBB_VIGUN (P17734) Bowman-Birk type seed trypsin and chymotrypsin inhibitor| (BTCI) Length = 83 Score = 35.8 bits (81), Expect = 0.026 Identities = 15/46 (32%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +3 Query: 201 CCDFXVCYRALPRACRCLD-EVEQCAPTCKSCQPAPSDPSRHVCND 335 CC C +++P CRC + + C CKSC S P+ C + Sbjct: 18 CCRZCACTKSIPPZCRCSZVRLNSCHSACKSCACTFSIPAZCFCGB 63
>IBB_PHAAU (P01062) Bowman-Birk type trypsin inhibitor| Length = 72 Score = 35.8 bits (81), Expect = 0.026 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +3 Query: 201 CCDFXVCYRALPRACRCLD-EVEQCAPTCKSCQPAPSDPSRHVCND 335 CCD C +++P C C + + C CKSC S P + C D Sbjct: 12 CCDSCDCTKSIPPECHCANIRLNSCHSACKSCICTRSMPGKCRCLD 57 Score = 32.7 bits (73), Expect = 0.22 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +3 Query: 204 CDFXVCYRALPRACRCLDEVEQCAPTCKS 290 C +C R++P CRCLD + C C+S Sbjct: 40 CKSCICTRSMPGKCRCLDTDDFCYKPCES 68
>IBB_PHAAT (P83311) Bowman-Birk type proteinase inhibitor (TBPI-B)| Length = 80 Score = 35.0 bits (79), Expect = 0.044 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = +3 Query: 201 CCDFXVCYRALPRACRCLDEVEQCAPTCKSCQPAPSDPSRHVCND 335 CCD C +++P CRC + C+SC S P++ VC D Sbjct: 19 CCDHCACTKSIPPQCRCALRLN--CNHCRSCICTFSIPAQCVCTD 61
>IBB2_ARAHY (P01067) Bowman-Birk type proteinase inhibitor B-II| Length = 63 Score = 35.0 bits (79), Expect = 0.044 Identities = 17/51 (33%), Positives = 20/51 (39%), Gaps = 2/51 (3%) Frame = +3 Query: 201 CCDFXVCYRALPR--ACRCLDEVEQCAPTCKSCQPAPSDPSRHVCNDRYTG 347 CC +C R P C C D + C C C S P + C DR G Sbjct: 5 CCSACICDRRAPPYFECTCGDTFDHCPAACNKCVCTRSIPPQCRCTDRTQG 55 Score = 27.7 bits (60), Expect = 7.1 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +3 Query: 204 CDFXVCYRALPRACRCLDEVEQCAP 278 C+ VC R++P CRC D + P Sbjct: 34 CNKCVCTRSIPPQCRCTDRTQGRCP 58
>IBB1_DIOGL (P82469) Bowman-Birk type proteinase inhibitor 1 (Bowman-Birk type| proteinase inhibitor I) (DgTI) Length = 67 Score = 32.3 bits (72), Expect = 0.29 Identities = 15/46 (32%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +3 Query: 201 CCDFXVCYRALPRACRCLD-EVEQCAPTCKSCQPAPSDPSRHVCND 335 CCD C ++ P C+C D + C C++C + S P C D Sbjct: 5 CCDRCRCTKSEPPQCQCQDVRLNSCHSACEACVCSHSMPGLCSCLD 50 Score = 31.2 bits (69), Expect = 0.64 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +3 Query: 204 CDFXVCYRALPRACRCLDEVEQCAPTCKS 290 C+ VC ++P C CLD C CKS Sbjct: 33 CEACVCSHSMPGLCSCLDITHFCHEPCKS 61
>IBBWP_MAIZE (P31862) Bowman-Birk type wound-induced proteinase inhibitor WIP1| precursor Length = 102 Score = 32.3 bits (72), Expect = 0.29 Identities = 19/60 (31%), Positives = 24/60 (40%), Gaps = 4/60 (6%) Frame = +3 Query: 198 KCCDFXVCYRALPRACRCLDEVEQCAPTCKSCQPAP----SDPSRHVCNDRYTGDIGPTC 365 KCC C + C D + C P CK C A S ++ C D + G GP C Sbjct: 45 KCC--TNCNFSFSGLYTCDDVKKDCDPVCKKCVVAVHASYSGNNKFRCTDTFLGMCGPKC 102
>NAS27_CAEEL (O17264) Zinc metalloproteinase nas-27 precursor (EC 3.4.24.21)| (Nematode astacin 27) Length = 428 Score = 31.6 bits (70), Expect = 0.49 Identities = 17/37 (45%), Positives = 21/37 (56%), Gaps = 4/37 (10%) Frame = +3 Query: 264 EQCAPTCKSCQ----PAPSDPSRHVCNDRYTGDIGPT 362 E+CA T CQ PAPSD S+ VC D + G+ T Sbjct: 256 ERCANTLNRCQQGGYPAPSDCSQCVCPDGFGGNFCET 292
>MUA3_CAEEL (P34576) Transmembrane cell adhesion receptor mua-3 precursor (Muscle| attachment abnormal protein 3) Length = 3767 Score = 30.4 bits (67), Expect = 1.1 Identities = 20/64 (31%), Positives = 25/64 (39%), Gaps = 8/64 (12%) Frame = +3 Query: 201 CCDFXVCYRALPRACRC------LDEVEQCAPTCKSCQPAP--SDPSRHVCNDRYTGDIG 356 C +CY PR RC +D + + C+P P S P RH C D D Sbjct: 2468 CSRNAICYDE-PRGYRCECKRGFMDRSPDSSQRGRVCEPPPPPSPPPRHPCQDPERNDCH 2526 Query: 357 PTCT 368 P T Sbjct: 2527 PAGT 2530
>SERC_LEGPA (Q5X5E7) Phosphoserine aminotransferase (EC 2.6.1.52) (PSAT)| Length = 362 Score = 29.3 bits (64), Expect = 2.4 Identities = 26/90 (28%), Positives = 40/90 (44%), Gaps = 21/90 (23%) Frame = -2 Query: 362 RGPYI---AGVPVVADMTG---------------WIGRCRLAALAGRSTLL---DLVKAA 246 R PY+ GVP+VADMT + G + A AG + ++ DL+K Sbjct: 158 RFPYVPKTGGVPLVADMTSCLLSEPININQYGLIFAGAQKNIANAGLTIVIIHEDLLKNQ 217 Query: 245 ARPRKRTVAHTEVAAFPRPLFVSPLLLRCY 156 P T+ + + A R L+ +P + CY Sbjct: 218 PEPAIPTMLNYKNHAEHRSLYATPPVFNCY 247
>MKRN2_BRARE (Q9DFG8) Makorin-2| Length = 414 Score = 28.9 bits (63), Expect = 3.2 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = -1 Query: 294 GSSCRSEHTARPRQGSGTPAEAHGSTHXSRSIST 193 G CR +H P +GSG PA+ H +RS S+ Sbjct: 48 GDRCRYDHIKPPGRGSGAPAD-----HSNRSSSS 76
>MCSP_RAT (Q64298) Sperm mitochondrial-associated cysteine-rich protein| Length = 145 Score = 28.9 bits (63), Expect = 3.2 Identities = 16/50 (32%), Positives = 21/50 (42%), Gaps = 1/50 (2%) Frame = +3 Query: 219 CYRALPRACRCLDEVEQCAPT-CKSCQPAPSDPSRHVCNDRYTGDIGPTC 365 C P AC C ++ C PT C C P + C + T + PTC Sbjct: 61 CPATCPAACACPCPMKPCCPTKCTCC------PKKCTCCPQPTCCVQPTC 104
>SALL1_HUMAN (Q9NSC2) Sal-like protein 1 (Zinc finger protein SALL1) (Spalt-like| transcription factor 1) (HSal1) Length = 1324 Score = 28.9 bits (63), Expect = 3.2 Identities = 17/50 (34%), Positives = 24/50 (48%) Frame = -1 Query: 342 CTGRCRHDGMDRTVPAGSSCRSEHTARPRQGSGTPAEAHGSTHXSRSIST 193 C+ H+G+DR S E + GSGT + +H ST S S S+ Sbjct: 110 CSDLSEHNGLDRE----ESMEVEAPVANKSGSGTSSGSHSSTAPSSSSSS 155
>IGF1R_XENLA (O73798) Insulin-like growth factor 1 receptor precursor (EC| 2.7.10.1) (xIGF-1R) (xIGFR) [Contains: Insulin-like growth factor 1 receptor alpha chain; Insulin-like growth factor 1 receptor beta chain] Length = 1358 Score = 28.9 bits (63), Expect = 3.2 Identities = 19/61 (31%), Positives = 24/61 (39%), Gaps = 5/61 (8%) Frame = +3 Query: 198 KCCDFXVCYRALPRAC---RCLDEVEQCAPTC-KSCQPAPSDPSRHVCNDR-YTGDIGPT 362 +C C + P C C D E C P C SC +D + C+ Y G PT Sbjct: 201 RCWSDEHCQKVCPSVCGKRACSDNNECCHPECLGSCTAPDNDTACVACHHYFYEGRCVPT 260 Query: 363 C 365 C Sbjct: 261 C 261
>CEK1_SCHPO (P38938) Serine/threonine-protein kinase cek1 (EC 2.7.11.1)| Length = 1338 Score = 28.5 bits (62), Expect = 4.2 Identities = 14/40 (35%), Positives = 19/40 (47%) Frame = -1 Query: 324 HDGMDRTVPAGSSCRSEHTARPRQGSGTPAEAHGSTHXSR 205 H G+ T+ A S S HTA P GT ++ H + R Sbjct: 1155 HKGVSSTMSASQSQSSMHTALPDVTEGTSSDEHTTIQKGR 1194
>NRCAM_CHICK (P35331) Neuronal cell adhesion molecule precursor (Nr-CAM)| (NgCAM-related cell adhesion molecule) (Ng-CAM-related) (hBravo) Length = 1284 Score = 28.1 bits (61), Expect = 5.4 Identities = 15/47 (31%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = +1 Query: 199 NAATSVCATVRFRGRAAALTRSSSVLRPARAASRHRPIHP-VMSATT 336 NA TSV + + A + + +LRPA A + +P++P + + TT Sbjct: 1005 NAQTSVGSGSQITEEAVTIMDEAGILRPAVGAGKVQPLYPRIRNVTT 1051
>PGBM_MOUSE (Q05793) Basement membrane-specific heparan sulfate proteoglycan core| protein precursor (HSPG) (Perlecan) (PLC) Length = 3707 Score = 27.7 bits (60), Expect = 7.1 Identities = 14/39 (35%), Positives = 15/39 (38%), Gaps = 3/39 (7%) Frame = +3 Query: 243 CRCLDEVEQCAP---TCKSCQPAPSDPSRHVCNDRYTGD 350 C C E C P C+SCQ S C Y GD Sbjct: 1159 CNCHGHSETCEPETGACQSCQHHTEGASCEQCQPGYYGD 1197
>BACS2_HALSA (P71411) Sensory rhodopsin-2 (Sensory rhodopsin II) (SR-II)| Length = 237 Score = 27.7 bits (60), Expect = 7.1 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +2 Query: 296 AGTVRSIPSCLQRPVHRRY 352 AGTV I C++ P HRRY Sbjct: 16 AGTVLPIRDCIRHPSHRRY 34
>KITH_BACTN (Q8A5G4) Thymidine kinase (EC 2.7.1.21)| Length = 199 Score = 27.7 bits (60), Expect = 7.1 Identities = 16/52 (30%), Positives = 21/52 (40%), Gaps = 5/52 (9%) Frame = +3 Query: 231 LPRACRCLDEVEQCAPTCKSCQPAPSDPSRHVCNDRY-----TGDIGPTCTE 371 +P+ C DEV + C C S R V ND+ T + P C E Sbjct: 135 MPQLCAIADEVSKVHAICVKCGDLASFSHRTVKNDKQVLLGETAEYEPLCRE 186
>INSR_XENLA (Q9PVZ4) Insulin receptor precursor (EC 2.7.10.1) (IR) (Xe-InsR)| (XTK-1b) [Contains: Insulin receptor alpha subunit; Insulin receptor beta subunit] Length = 1362 Score = 27.7 bits (60), Expect = 7.1 Identities = 16/54 (29%), Positives = 23/54 (42%), Gaps = 8/54 (14%) Frame = +3 Query: 198 KCCDFXVCYRALPRACR---CLDEVEQCAPTCKSCQPAPSDPS-----RHVCND 335 +C C + P C+ CL + + C P C P+DPS RH N+ Sbjct: 218 RCWTQDHCQKVCPSDCKGSGCLPDGQCCHPECLGSCRKPNDPSECTACRHFQNE 271
>RPC1_BPMU (P06019) Repressor protein CI| Length = 174 Score = 27.3 bits (59), Expect = 9.3 Identities = 11/45 (24%), Positives = 24/45 (53%) Frame = -2 Query: 350 IAGVPVVADMTGWIGRCRLAALAGRSTLLDLVKAAARPRKRTVAH 216 +AGV A++ GW + + G++ D++ + R++ +AH Sbjct: 10 VAGVHYRANVQGWTKQKKEGVKGGKAVEYDVMSMPTKEREQVIAH 54
>LAMB1_DROME (P11046) Laminin beta-1 chain precursor (Laminin B1 chain)| Length = 1790 Score = 27.3 bits (59), Expect = 9.3 Identities = 14/41 (34%), Positives = 18/41 (43%), Gaps = 3/41 (7%) Frame = +3 Query: 237 RACRCLDEVEQCAP---TCKSCQPAPSDPSRHVCNDRYTGD 350 R C+C C P TC CQ + + S C D Y G+ Sbjct: 883 RVCQCNGHAATCDPIQGTCIDCQDSTTGYSCDSCLDGYYGN 923
>CYAA_NEUCR (Q01631) Adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase)| (Adenylyl cyclase) Length = 2300 Score = 27.3 bits (59), Expect = 9.3 Identities = 9/20 (45%), Positives = 15/20 (75%) Frame = +2 Query: 272 CSDLQELPAGTVRSIPSCLQ 331 C+DL ++P GT+RS P ++ Sbjct: 1383 CNDLSDMPQGTIRSWPQLVE 1402
>SERC_LEGPL (Q5WWT0) Phosphoserine aminotransferase (EC 2.6.1.52) (PSAT)| Length = 362 Score = 27.3 bits (59), Expect = 9.3 Identities = 25/90 (27%), Positives = 40/90 (44%), Gaps = 21/90 (23%) Frame = -2 Query: 362 RGPYI---AGVPVVADMTG---------------WIGRCRLAALAGRSTLL---DLVKAA 246 R PY+ GVP+VADMT + G + A AG + ++ +L+K Sbjct: 158 RFPYVPKTGGVPLVADMTSCLLSEPININQYGLIFAGAQKNIANAGLTVVIIHEELLKNQ 217 Query: 245 ARPRKRTVAHTEVAAFPRPLFVSPLLLRCY 156 P T+ + + A R L+ +P + CY Sbjct: 218 PEPVIPTMLNYKNHAEHRSLYATPPVFNCY 247 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,944,373 Number of Sequences: 219361 Number of extensions: 900226 Number of successful extensions: 3269 Number of sequences better than 10.0: 56 Number of HSP's better than 10.0 without gapping: 3001 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3244 length of database: 80,573,946 effective HSP length: 99 effective length of database: 58,857,207 effective search space used: 1412572968 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)