| Clone Name | bags15f24 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GPR89_BOVIN (Q5BIM9) Protein GPR89A | 29 | 8.9 | 2 | GPR89_MOUSE (Q8BS95) Protein GPR89A | 29 | 8.9 | 3 | GPR89_HUMAN (Q9Y302) Protein GPR89A (Putative MAPK-activating pr... | 29 | 8.9 |
|---|
>GPR89_BOVIN (Q5BIM9) Protein GPR89A| Length = 423 Score = 29.3 bits (64), Expect = 8.9 Identities = 17/54 (31%), Positives = 30/54 (55%), Gaps = 2/54 (3%) Frame = +3 Query: 414 ISVLPFTISIYMVSSLILRRLWLSFTFNCLLYSLFIGYFWT--RHFPVILNKCG 569 + ++PF I ++VS++ L F+CLL+ F+ +FW FP++ K G Sbjct: 87 VFMVPFYIGYFIVSNIRLLHKQ-RLLFSCLLWLTFMYFFWKLGDPFPILSPKHG 139
>GPR89_MOUSE (Q8BS95) Protein GPR89A| Length = 455 Score = 29.3 bits (64), Expect = 8.9 Identities = 17/54 (31%), Positives = 30/54 (55%), Gaps = 2/54 (3%) Frame = +3 Query: 414 ISVLPFTISIYMVSSLILRRLWLSFTFNCLLYSLFIGYFWT--RHFPVILNKCG 569 + ++PF I ++VS++ L F+CLL+ F+ +FW FP++ K G Sbjct: 87 VFMVPFYIGYFIVSNIQLLHKQ-RLLFSCLLWLTFMYFFWKLGDPFPILSPKHG 139
>GPR89_HUMAN (Q9Y302) Protein GPR89A (Putative MAPK-activating protein PM01)| (Putative NF-kappa-B-activating protein 90) Length = 455 Score = 29.3 bits (64), Expect = 8.9 Identities = 17/54 (31%), Positives = 30/54 (55%), Gaps = 2/54 (3%) Frame = +3 Query: 414 ISVLPFTISIYMVSSLILRRLWLSFTFNCLLYSLFIGYFWT--RHFPVILNKCG 569 + ++PF I ++VS++ L F+CLL+ F+ +FW FP++ K G Sbjct: 87 VFMVPFYIGYFIVSNIRLLHKQ-RLLFSCLLWLTFMYFFWKLGDPFPILSPKHG 139 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 68,102,172 Number of Sequences: 219361 Number of extensions: 1095642 Number of successful extensions: 2983 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2906 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2983 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 5158951200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)