| Clone Name | rbaal9m23 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RL7A_ICTPU (Q90YW2) 60S ribosomal protein L7a | 32 | 2.2 | 2 | ARS_PSEAE (P51691) Arylsulfatase (EC 3.1.6.1) (AS) (Aryl-sulfate... | 30 | 4.9 | 3 | SDC2_XENLA (P49414) Syndecan-2 precursor (SYND2) (Xsyn-2) | 30 | 6.4 | 4 | RL7A_FUGRU (O57592) 60S ribosomal protein L7a (Surfeit locus pro... | 30 | 8.3 |
|---|
>RL7A_ICTPU (Q90YW2) 60S ribosomal protein L7a| Length = 265 Score = 31.6 bits (70), Expect = 2.2 Identities = 19/57 (33%), Positives = 29/57 (50%), Gaps = 3/57 (5%) Frame = +1 Query: 370 PHVARYSEKVCQL*PIFQTSDV---VTQQHAPE*QACKIITWDRY*RLKREGSILHK 531 P VA+ E + P+F+ + Q P+ + + W RY RL+R GSIL+K Sbjct: 15 PSVAKKHEVKKVVNPLFEKRPKNFGIGQDIQPKRDLTRFVKWPRYVRLQRHGSILYK 71
>ARS_PSEAE (P51691) Arylsulfatase (EC 3.1.6.1) (AS) (Aryl-sulfate| sulphohydrolase) Length = 535 Score = 30.4 bits (67), Expect = 4.9 Identities = 13/25 (52%), Positives = 18/25 (72%) Frame = +1 Query: 490 RY*RLKREGSILHKLCTVIVLTPTI 564 RY RL R+G+I H TV+ +TPT+ Sbjct: 389 RYPRLSRQGAISHAFATVMDVTPTL 413
>SDC2_XENLA (P49414) Syndecan-2 precursor (SYND2) (Xsyn-2)| Length = 191 Score = 30.0 bits (66), Expect = 6.4 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = -2 Query: 372 GSFPIDDDHFI*ESFTGFVRSISEEDENVLAKRPQKLL 259 G++P+DDD + S +G +EDENV+ Q L+ Sbjct: 37 GNYPVDDDDYSSGSGSGIPARGDDEDENVVLTTVQTLI 74
>RL7A_FUGRU (O57592) 60S ribosomal protein L7a (Surfeit locus protein 3)| Length = 265 Score = 29.6 bits (65), Expect = 8.3 Identities = 18/57 (31%), Positives = 29/57 (50%), Gaps = 3/57 (5%) Frame = +1 Query: 370 PHVARYSEKVCQL*PIFQTSDV---VTQQHAPE*QACKIITWDRY*RLKREGSILHK 531 P VA+ E + P+F+ + Q P+ + + W RY RL+R+ SIL+K Sbjct: 15 PSVAKKHEAKKVVNPLFEKRPKNFGIGQDIQPKRDLTRFVKWPRYIRLQRQRSILYK 71 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 99,661,068 Number of Sequences: 219361 Number of extensions: 2128353 Number of successful extensions: 4824 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4672 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4823 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6314008338 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)