| Clone Name | rbaal9m22 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YAE9_YEAST (P39721) Protein YAL049C | 40 | 0.002 | 2 | E134_MAIZE (Q9ZT66) Endo-1,3;1,4-beta-D-glucanase precursor (EC ... | 31 | 1.4 | 3 | Y1265_HAEIN (P44144) Hypothetical UPF0142 protein HI1265 | 29 | 5.3 | 4 | METX_MOOTA (Q2RIW8) Homoserine O-acetyltransferase (EC 2.3.1.31)... | 29 | 5.3 | 5 | BPT1_YEAST (P14772) Bile pigment transporter 1 | 28 | 9.0 | 6 | ZNF8_HUMAN (P17098) Zinc finger protein 8 (Zinc finger protein H... | 28 | 9.0 |
|---|
>YAE9_YEAST (P39721) Protein YAL049C| Length = 246 Score = 40.0 bits (92), Expect = 0.002 Identities = 25/74 (33%), Positives = 36/74 (48%) Frame = -2 Query: 422 KCPIAVLGAETDVMSPPELVKEFEQVLSSNSGIAHFVKIFPGVSHGWTVRYNGEDAAAVK 243 K PI + AE D + P L E+ L N + + +F GV+HG+ R + A Sbjct: 169 KKPILISAAEEDHIFPANLRHLTEEKLKDNHA-TYQLDLFSGVAHGFAARGDISIPAVKY 227 Query: 242 SAEEALTDMIDWFN 201 + E+ L D I WFN Sbjct: 228 AKEKVLLDQIYWFN 241
>E134_MAIZE (Q9ZT66) Endo-1,3;1,4-beta-D-glucanase precursor (EC 3.2.1.-)| Length = 303 Score = 30.8 bits (68), Expect = 1.4 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = -2 Query: 425 VKCPIAVLGAETDVMSPPELVKEFEQVL 342 VK PI +LGA+ D +PP+ V F VL Sbjct: 186 VKWPIEILGAQNDTTTPPKEVYRFVHVL 213
>Y1265_HAEIN (P44144) Hypothetical UPF0142 protein HI1265| Length = 587 Score = 28.9 bits (63), Expect = 5.3 Identities = 22/87 (25%), Positives = 39/87 (44%), Gaps = 1/87 (1%) Frame = -2 Query: 389 DVMSPPELVKEFE-QVLSSNSGIAHFVKIFPGVSHGWTVRYNGEDAAAVKSAEEALTDMI 213 D + EL++E + Q + + + F+ I + GWT GE + + A L + Sbjct: 424 DAETYQELLEELDGQDIDDATRVREFIGIVAPKNSGWTTLRVGELKSMLHLALGELEQAL 483 Query: 212 DWFNKNLK*T*ISGPPFVITNKPVSFF 132 DW N L + V T +PV+++ Sbjct: 484 DWANWTL-----NMNSSVFTTEPVNYY 505
>METX_MOOTA (Q2RIW8) Homoserine O-acetyltransferase (EC 2.3.1.31) (Homoserine| O-trans-acetylase) (Homoserine transacetylase) (HTA) Length = 374 Score = 28.9 bits (63), Expect = 5.3 Identities = 12/44 (27%), Positives = 22/44 (50%) Frame = -2 Query: 419 CPIAVLGAETDVMSPPELVKEFEQVLSSNSGIAHFVKIFPGVSH 288 CP +G +D + PP V+E ++++ G A + +I H Sbjct: 304 CPCLGIGISSDFLFPPYQVQEIVRMINDGGGHARYAEIDSPYGH 347
>BPT1_YEAST (P14772) Bile pigment transporter 1| Length = 1559 Score = 28.1 bits (61), Expect = 9.0 Identities = 8/23 (34%), Positives = 18/23 (78%) Frame = +2 Query: 236 RRSLQQPHLRHYISRSIHEKPQG 304 +R+++Q HL+ ++ + +H KP+G Sbjct: 1409 KRAVEQAHLKPHLEKMLHSKPRG 1431
>ZNF8_HUMAN (P17098) Zinc finger protein 8 (Zinc finger protein HF.18)| Length = 575 Score = 28.1 bits (61), Expect = 9.0 Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Frame = +2 Query: 245 LQQPHL-RHYISRSIHEKPQGRS*QSEQSLS 334 +Q HL RH I+ + E+P GRS + EQS S Sbjct: 477 IQSSHLIRHQITHTREEQPHGRSRRREQSSS 507 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,936,256 Number of Sequences: 219361 Number of extensions: 1180067 Number of successful extensions: 3324 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 3256 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3324 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2336739400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)