| Clone Name | bags15e06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | NUO6_SOLTU (P80729) NADH-ubiquinone oxidoreductase 11 kDa subuni... | 38 | 0.021 | 2 | DRE2B_ARATH (O82133) Dehydration-responsive element-binding prot... | 30 | 5.6 |
|---|
>NUO6_SOLTU (P80729) NADH-ubiquinone oxidoreductase 11 kDa subunit (EC 1.6.5.3)| (EC 1.6.99.3) (Complex I-11KD) (CI-11KD) (Fragment) Length = 19 Score = 37.7 bits (86), Expect = 0.021 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = +2 Query: 104 GFIMEFAENLILRLMEDPE 160 GFIMEFAENLILR MEDP+ Sbjct: 1 GFIMEFAENLILRRMEDPK 19
>DRE2B_ARATH (O82133) Dehydration-responsive element-binding protein 2B (DREB2B| protein) Length = 330 Score = 29.6 bits (65), Expect = 5.6 Identities = 15/65 (23%), Positives = 34/65 (52%), Gaps = 1/65 (1%) Frame = +2 Query: 110 IMEFAENLILRLMEDPEQRDEAQRAHVYRMKERCERTKAAWALPLRPYGF-WTFDRFNSQ 286 ++EF + +++++ E+ + + + +E+ ++ L + YG+ W+ D N Q Sbjct: 211 LLEFEQQYWGQVLQEKEKPKQEEEEIQQQQQEQQQQQLQPDLLTVADYGWPWSNDIVNDQ 270 Query: 287 LSWDP 301 SWDP Sbjct: 271 TSWDP 275 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,051,733 Number of Sequences: 219361 Number of extensions: 573306 Number of successful extensions: 1469 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1459 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1469 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4258037034 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)