| Clone Name | bags14k01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PRIA_MYCLE (Q9CCQ3) Putative primosomal protein N' (EC 3.6.1.-) ... | 30 | 4.6 | 2 | MUTS_ZYMMO (Q5NL79) DNA mismatch repair protein mutS | 30 | 7.8 |
|---|
>PRIA_MYCLE (Q9CCQ3) Putative primosomal protein N' (EC 3.6.1.-) (ATP-dependent| helicase priA) (Replication factor Y) Length = 651 Score = 30.4 bits (67), Expect = 4.6 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +2 Query: 422 LCCWCTNIDLTVSCSWC 472 +CCWC DLT+ C+ C Sbjct: 398 VCCWCGRADLTLRCARC 414
>MUTS_ZYMMO (Q5NL79) DNA mismatch repair protein mutS| Length = 891 Score = 29.6 bits (65), Expect = 7.8 Identities = 16/32 (50%), Positives = 19/32 (59%) Frame = +3 Query: 453 LFLAVGANGSGKSNFLHANALKHLENQTFSYV 548 L+L G N GKS FL NAL + QT S+V Sbjct: 635 LWLVTGPNMGGKSTFLRQNALLAVLAQTGSFV 666 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 79,250,362 Number of Sequences: 219361 Number of extensions: 1378321 Number of successful extensions: 3391 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3301 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3390 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5881538857 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)