| Clone Name | bags14j16 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SLIP1_DROME (Q8MR31) Slo-interacting protein 1 (dSLIP1) | 32 | 1.2 | 2 | DDL_ENTGA (Q47823) D-alanine--D-alanine ligase (EC 6.3.2.4) (D-a... | 30 | 6.0 | 3 | ENTK_BOVIN (P98072) Enteropeptidase precursor (EC 3.4.21.9) (Ent... | 29 | 7.8 |
|---|
>SLIP1_DROME (Q8MR31) Slo-interacting protein 1 (dSLIP1)| Length = 767 Score = 32.0 bits (71), Expect = 1.2 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +3 Query: 45 NPKSIENLAFHEGSGLDAVVKRIIYKTDDDDYDSHHSEANS 167 N + +E + + +V RI+Y DDDD D H AN+ Sbjct: 257 NQEELETQIARSSTSVTLLVSRILYPEDDDDEDIHFEYANT 297
>DDL_ENTGA (Q47823) D-alanine--D-alanine ligase (EC 6.3.2.4) (D-alanylalanine| synthetase) (D-Ala-D-Ala ligase) (Fragment) Length = 316 Score = 29.6 bits (65), Expect = 6.0 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = +1 Query: 352 LSCLPAHSVVGMIYINLLEWSILLLERSAMWLSG 453 +S L A SVV +Y N + ++++ R WL G Sbjct: 16 VSLLSAFSVVNAVYYNYYQVQLVMITRDGQWLKG 49
>ENTK_BOVIN (P98072) Enteropeptidase precursor (EC 3.4.21.9) (Enterokinase)| [Contains: Enteropeptidase non-catalytic heavy chain; Enteropeptidase catalytic light chain] Length = 1035 Score = 29.3 bits (64), Expect = 7.8 Identities = 23/104 (22%), Positives = 45/104 (43%), Gaps = 2/104 (1%) Frame = +3 Query: 39 FLNPKSIENLAFHEGSGLDAVVKRIIYKTDDDDYDSHHSEANSTYLLQHAEATRFNLFTG 218 + N + L +EG G +++ ++ + ++ +T+L+Q E+ + G Sbjct: 287 YFNTYYADVLNIYEGMGSSKILRASLWSNNPGIIRIFSNQVTATFLIQSDESD----YIG 342 Query: 219 FQTVSEREESFKVNETVNVHCGFYSDNGGFKISD--DDVRYMRT 344 F+ S ++N ++C F D F I D DD + RT Sbjct: 343 FKVTYTAFNSKELNNYEKINCNF-EDGFCFWIQDLNDDNEWERT 385 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 77,372,342 Number of Sequences: 219361 Number of extensions: 1486443 Number of successful extensions: 3865 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3769 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3865 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4528412720 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)