| Clone Name | bags14g12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TOPRS_MOUSE (Q80Z37) Ubiquitin-protein E3 ligase Topors (EC 6.3.... | 30 | 2.5 | 2 | TOPRS_HUMAN (Q9NS56) Ubiquitin-protein E3 ligase Topors (EC 6.3.... | 29 | 5.5 | 3 | FADI_ECO57 (Q8XCN9) 3-ketoacyl-CoA thiolase (EC 2.3.1.16) (Fatty... | 28 | 7.2 |
|---|
>TOPRS_MOUSE (Q80Z37) Ubiquitin-protein E3 ligase Topors (EC 6.3.2.-)| (SUMO1-protein E3 ligase Topors) (Topoisomerase I-binding RING finger protein) (Topoisomerase I-binding arginine/serine-rich protein) (Tumor suppressor p53-binding protein 3) (p53-bindi Length = 1033 Score = 30.0 bits (66), Expect = 2.5 Identities = 14/51 (27%), Positives = 25/51 (49%) Frame = -3 Query: 431 FFLKKNSDVKYTWAYTYTAPSIEQSDYYPRQLRR*TKRSI*TTNESTKRYR 279 ++L+ N KY W YTY + + ++ Y RR R+ + S+ +R Sbjct: 690 YYLRNNYGSKYKWEYTYYSRNKDRDGYESSYRRRTLSRAHYSRQSSSPEFR 740
>TOPRS_HUMAN (Q9NS56) Ubiquitin-protein E3 ligase Topors (EC 6.3.2.-)| (SUMO1-protein E3 ligase Topors) (Topoisomerase I-binding RING finger protein) (Topoisomerase I-binding arginine/serine-rich protein) (Tumor suppressor p53-binding protein 3) (p53-bindi Length = 1045 Score = 28.9 bits (63), Expect = 5.5 Identities = 13/51 (25%), Positives = 25/51 (49%) Frame = -3 Query: 431 FFLKKNSDVKYTWAYTYTAPSIEQSDYYPRQLRR*TKRSI*TTNESTKRYR 279 ++L+ N +Y W YTY + + ++ Y RR R+ + S+ +R Sbjct: 690 YYLRNNYGSRYKWEYTYYSRNKDRDGYESSYRRRTLSRAHYSRQSSSPEFR 740
>FADI_ECO57 (Q8XCN9) 3-ketoacyl-CoA thiolase (EC 2.3.1.16) (Fatty acid| oxidation complex beta subunit) (Beta-ketothiolase) (Acetyl-CoA acyltransferase) (Acyl-CoA ligase) (ACSs) Length = 436 Score = 28.5 bits (62), Expect = 7.2 Identities = 16/63 (25%), Positives = 30/63 (47%) Frame = -2 Query: 189 RCCSELGDEVVDVVADLLRPLLLDEVAGAGDDDQLLQQRHVGLEPALVQVVLDXRRSGTS 10 R C+ V +VV L+ + +AG D +L +G+ L +V++D ++ T Sbjct: 97 RACATSFQAVANVVESLMAGTIRAGIAGGADSSSVLP---IGVSKKLARVLVDVNKARTM 153 Query: 9 GRR 1 +R Sbjct: 154 SQR 156 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,656,181 Number of Sequences: 219361 Number of extensions: 734029 Number of successful extensions: 1677 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1658 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1674 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2453576370 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)