| Clone Name | rbaal9k09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | K0196_MOUSE (Q8C2E7) Protein KIAA0196 | 32 | 0.58 | 2 | K0196_HUMAN (Q12768) Protein KIAA0196 | 31 | 1.3 | 3 | MCH1_EMENI (Q5AXV1) Probable transporter mch1 | 28 | 6.4 | 4 | ZN451_HUMAN (Q9Y4E5) Zinc finger protein 451 (Coactivator for st... | 28 | 8.3 |
|---|
>K0196_MOUSE (Q8C2E7) Protein KIAA0196| Length = 1159 Score = 32.0 bits (71), Expect = 0.58 Identities = 22/64 (34%), Positives = 33/64 (51%) Frame = -1 Query: 242 TRSFMRGLIRTAVINIHMEIVRTVDISVLQTYEDHHAIAIWLVADKLTSIQTESINIRRS 63 TR F+ +IRT INI E++ TV I ++ W + D TSI ESI + S Sbjct: 527 TRKFLHQMIRT--INIKEEVLITVQIIGDLSFA-------WQLIDSFTSIMQESIRVNPS 577 Query: 62 VLVQ 51 ++ + Sbjct: 578 MVTK 581
>K0196_HUMAN (Q12768) Protein KIAA0196| Length = 1159 Score = 30.8 bits (68), Expect = 1.3 Identities = 21/64 (32%), Positives = 33/64 (51%) Frame = -1 Query: 242 TRSFMRGLIRTAVINIHMEIVRTVDISVLQTYEDHHAIAIWLVADKLTSIQTESINIRRS 63 TR F+ +IRT INI E++ T+ I ++ W + D TSI ESI + S Sbjct: 527 TRKFLHQMIRT--INIKEEVLITMQIVGDLSFA-------WQLIDSFTSIMQESIRVNPS 577 Query: 62 VLVQ 51 ++ + Sbjct: 578 MVTK 581
>MCH1_EMENI (Q5AXV1) Probable transporter mch1| Length = 615 Score = 28.5 bits (62), Expect = 6.4 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = -3 Query: 384 WRLVERTYAPVVIVGDQNCGETDYWRWTLFCCVLL 280 W+ TY + D NCG+ D +++ LF +LL Sbjct: 234 WQSQVGTYFLCERLKDSNCGDVDVYKYFLFLAILL 268
>ZN451_HUMAN (Q9Y4E5) Zinc finger protein 451 (Coactivator for steroid| receptors) Length = 1061 Score = 28.1 bits (61), Expect = 8.3 Identities = 14/36 (38%), Positives = 24/36 (66%), Gaps = 1/36 (2%) Frame = -1 Query: 188 EIVRTVDISVLQTYEDHHAIAIWLVADKL-TSIQTE 84 +++ V+ + L YE+HH+I V++K TSI+TE Sbjct: 673 DLIFNVEEAFLSHYEEHHSIDYVFVSEKTETSIKTE 708 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,954,370 Number of Sequences: 219361 Number of extensions: 929555 Number of successful extensions: 1973 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1950 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1973 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2169600302 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)