| Clone Name | bags13k16 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CNGC4_ARATH (Q94AS9) Cyclic nucleotide-gated ion channel 4 (AtCN... | 30 | 5.4 | 2 | NU4M_DINSE (O79555) NADH-ubiquinone oxidoreductase chain 4 (EC 1... | 30 | 7.0 |
|---|
>CNGC4_ARATH (Q94AS9) Cyclic nucleotide-gated ion channel 4 (AtCNGC4) (Cyclic| nucleotide-and calmodulin-regulated ion channel 4) (AtHLM1) Length = 694 Score = 30.0 bits (66), Expect = 5.4 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +1 Query: 481 IPLKFAKRMRYYERGRWSCTRG 546 +P+ F +R+R YER RW+ RG Sbjct: 443 LPIGFRQRVRNYERQRWAAMRG 464
>NU4M_DINSE (O79555) NADH-ubiquinone oxidoreductase chain 4 (EC 1.6.5.3) (NADH| dehydrogenase subunit 4) Length = 445 Score = 29.6 bits (65), Expect = 7.0 Identities = 17/45 (37%), Positives = 24/45 (53%) Frame = -3 Query: 151 MYNLTSS*TFSTYILFIGNTRY*PIIFETLQETQKRFRFLLKTIS 17 MY LT+S T ILFI NT P +F + +T + L+ I+ Sbjct: 145 MYTLTTSMPLLTAILFINNTTNTPTLFMQMMQTTSPWTELMLWIA 189 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 84,403,805 Number of Sequences: 219361 Number of extensions: 1711859 Number of successful extensions: 3077 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2986 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3077 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5310515667 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)