| Clone Name | rbaal9i14 |
|---|---|
| Clone Library Name | barley_pub |
>DAPB_ANASP (Q8YU19) Dihydrodipicolinate reductase (EC 1.3.1.26) (DHPR)| Length = 278 Score = 28.9 bits (63), Expect = 3.6 Identities = 17/67 (25%), Positives = 29/67 (43%), Gaps = 11/67 (16%) Frame = +1 Query: 16 NLLSTEEDAITRCNMLRNYIYGMI-----------YYFKVQLLEMHKNRICGFALAAGAE 162 NL E A T C ++ N+ GM+ Y+ V+++E+H N+ + Sbjct: 122 NLADFAEKASTGCLIIPNFSIGMVLLQQAAVTASQYFDHVEIIELHHNQKADAPSGTAIQ 181 Query: 163 TEHVFAE 183 T + AE Sbjct: 182 TAELLAE 188
>SCFD1_HUMAN (Q8WVM8) Sec1 family domain-containing protein 1 (Syntaxin-binding| protein 1-like 2) (Sly1p) Length = 641 Score = 28.5 bits (62), Expect = 4.7 Identities = 21/63 (33%), Positives = 30/63 (47%), Gaps = 3/63 (4%) Frame = +1 Query: 13 YNLLSTEEDAITRCNMLRNYIYGMIYYFKVQLLEMHK-NRICGFALAAGAETE--HVFAE 183 Y ++ TEE+ C LRN +Y Y + + K I ALAA A T+ VF + Sbjct: 89 YFVMPTEENIDRMCQDLRNQLYESYYLNFISAISRSKLEDIANAALAASAVTQVAKVFDQ 148 Query: 184 NVN 192 +N Sbjct: 149 YLN 151
>FLID_AQUAE (O67805) Flagellar hook-associated protein 2 (HAP2) (Filament cap| protein) (Flagellar cap protein) Length = 441 Score = 28.5 bits (62), Expect = 4.7 Identities = 19/86 (22%), Positives = 38/86 (44%), Gaps = 12/86 (13%) Frame = +1 Query: 1 HEMPYNLLSTEEDAITRCNMLRNYIYGMIYY----FKVQLLEMHKNR--------ICGFA 144 + + Y+L+ T +D + + N ++Y+ IYY +K+ L E + + A Sbjct: 143 YTIDYSLIDTLKDIVNKINETQDYVKASIYYDGNKYKLMLAETSEENSTVETAPDLSTKA 202 Query: 145 LAAGAETEHVFAENVNRQDTRRSKIR 222 + H F NV Q + ++I+ Sbjct: 203 IHLLGTLPHQFGNNVLIQQAKNARIQ 228
>SCFD1_MOUSE (Q8BRF7) Sec1 family domain-containing protein 1 (Syntaxin-binding| protein 1-like 2) Length = 639 Score = 28.1 bits (61), Expect = 6.1 Identities = 21/63 (33%), Positives = 30/63 (47%), Gaps = 3/63 (4%) Frame = +1 Query: 13 YNLLSTEEDAITRCNMLRNYIYGMIYYFKVQLLEMHK-NRICGFALAAGAETE--HVFAE 183 Y ++ TEE+ C LRN +Y Y + + K I ALAA A T+ VF + Sbjct: 87 YFVMPTEENIDRLCQDLRNQLYESYYLNFISAISRSKLEDIANAALAASAVTQVAKVFDQ 146 Query: 184 NVN 192 +N Sbjct: 147 YLN 149
>SCFD1_RAT (Q62991) Sec1 family domain-containing protein 1 (Syntaxin-binding| protein 1-like 2) (Vesicle transport-related protein Ra410) (Sly1p) Length = 637 Score = 28.1 bits (61), Expect = 6.1 Identities = 21/63 (33%), Positives = 30/63 (47%), Gaps = 3/63 (4%) Frame = +1 Query: 13 YNLLSTEEDAITRCNMLRNYIYGMIYYFKVQLLEMHK-NRICGFALAAGAETE--HVFAE 183 Y ++ TEE+ C LRN +Y Y + + K I ALAA A T+ VF + Sbjct: 85 YFVMPTEENIDRLCQDLRNQLYESYYLNFISAISRSKLEDIANAALAANAVTQVAKVFDQ 144 Query: 184 NVN 192 +N Sbjct: 145 YLN 147
>BAR3_CHITE (Q03376) Balbiani ring protein 3 precursor| Length = 1700 Score = 28.1 bits (61), Expect = 6.1 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = -2 Query: 194 LLTFSANTCSVSAPAAKAKP 135 ++ ++ANTCS PA KAKP Sbjct: 1286 VMKWNANTCSCECPADKAKP 1305 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,025,683 Number of Sequences: 219361 Number of extensions: 636611 Number of successful extensions: 1390 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1369 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1390 length of database: 80,573,946 effective HSP length: 67 effective length of database: 65,876,759 effective search space used: 1581042216 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)