| Clone Name | bags12n04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | DNAJ_BLOFL (Q7VQL3) Chaperone protein dnaJ | 31 | 1.9 | 2 | MATK_CYPCL (Q6J9Z4) Maturase K (Intron maturase) | 30 | 5.6 | 3 | ORYA_ORYSA (P25776) Oryzain alpha chain precursor (EC 3.4.22.-) | 29 | 9.6 | 4 | ZIC5_HUMAN (Q96T25) Zinc finger protein ZIC 5 (Zinc finger prote... | 29 | 9.6 |
|---|
>DNAJ_BLOFL (Q7VQL3) Chaperone protein dnaJ| Length = 377 Score = 31.2 bits (69), Expect = 1.9 Identities = 20/78 (25%), Positives = 35/78 (44%), Gaps = 2/78 (2%) Frame = -3 Query: 262 FLEVMKAAAEMRSTRSSSRLKQEEVWVE--IRQVIHHICCQSMDRVVCVQCPASS*KQKQ 89 F ++ + RS R S E+ +E ++ V+ IC ++ V C+QC S K Sbjct: 99 FGDIFGGSRRSRSRRGSDLRYDIELSLEEAVKGVVREICVPTL--VTCLQCRGSGAKSSA 156 Query: 88 PFQLAVVXHEEGEVKRRR 35 V H G+++ R+ Sbjct: 157 SIVSCVTCHGHGQIQMRQ 174
>MATK_CYPCL (Q6J9Z4) Maturase K (Intron maturase)| Length = 516 Score = 29.6 bits (65), Expect = 5.6 Identities = 14/41 (34%), Positives = 25/41 (60%) Frame = -3 Query: 247 KAAAEMRSTRSSSRLKQEEVWVEIRQVIHHICCQSMDRVVC 125 K ++ +RST S L++ +V+I +I +CC S R++C Sbjct: 239 KQSSYLRSTSSGVFLERTHFYVKIEHLIV-VCCNSFHRILC 278
>ORYA_ORYSA (P25776) Oryzain alpha chain precursor (EC 3.4.22.-)| Length = 458 Score = 28.9 bits (63), Expect = 9.6 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +1 Query: 184 PTPPPVLVENYYEC 225 PTPPP + +NYY C Sbjct: 360 PTPPPTVCDNYYTC 373
>ZIC5_HUMAN (Q96T25) Zinc finger protein ZIC 5 (Zinc finger protein of the| cerebellum 5) Length = 639 Score = 28.9 bits (63), Expect = 9.6 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = +1 Query: 127 KLLCPWIDNICDESLALFPPTPPP 198 +L+C WID DE L PP PPP Sbjct: 371 ELICKWIDP--DELAGLPPPPPPP 392 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 76,096,205 Number of Sequences: 219361 Number of extensions: 1441314 Number of successful extensions: 3960 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3829 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3956 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4258037034 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)