| Clone Name | bags12m22 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MUTS_BORBU (O51737) DNA mismatch repair protein mutS | 32 | 1.6 | 2 | MUTS_BORGA (Q65ZX6) DNA mismatch repair protein mutS | 31 | 2.7 |
|---|
>MUTS_BORBU (O51737) DNA mismatch repair protein mutS| Length = 862 Score = 31.6 bits (70), Expect = 1.6 Identities = 15/53 (28%), Positives = 27/53 (50%) Frame = -3 Query: 380 SLQNEFSSMWSIFRNIQDVKCTRYI*YSIKFF*SRIQMFIPLIKIFNSMNFKF 222 +L+ F ++W I R I ++ RYI F + +F + K+F+ NF + Sbjct: 335 TLRETFINIWDIERIISRIQMKRYIKKDFLFIEKALSVFFTVKKLFDKHNFDY 387
>MUTS_BORGA (Q65ZX6) DNA mismatch repair protein mutS| Length = 862 Score = 30.8 bits (68), Expect = 2.7 Identities = 15/53 (28%), Positives = 27/53 (50%) Frame = -3 Query: 380 SLQNEFSSMWSIFRNIQDVKCTRYI*YSIKFF*SRIQMFIPLIKIFNSMNFKF 222 +L+ F ++W I R I ++ RYI F + +F + K+F+ NF + Sbjct: 335 TLREAFINIWDIERIISRIQMKRYIKKDFLFIEKALSVFFLVKKLFDKHNFDY 387 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 72,049,691 Number of Sequences: 219361 Number of extensions: 1344476 Number of successful extensions: 2840 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2803 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2839 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4585734400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)