| Clone Name | bags12m01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PML_HUMAN (P29590) Probable transcription factor PML (Tripartite... | 31 | 2.3 | 2 | 6PGD_BUCAI (P57208) 6-phosphogluconate dehydrogenase, decarboxyl... | 30 | 5.1 |
|---|
>PML_HUMAN (P29590) Probable transcription factor PML (Tripartite motif| protein 19) (RING finger protein 71) Length = 882 Score = 30.8 bits (68), Expect = 2.3 Identities = 24/80 (30%), Positives = 32/80 (40%), Gaps = 6/80 (7%) Frame = +2 Query: 35 CSLVPCRR------XQXGRRVKLARSSPI*PLPRXAAVEAKPRDSGAESSHGEVLCVELE 196 CS C R + G+ +LARSSP P P + + P G S V+ E+ Sbjct: 479 CSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVF 538 Query: 197 EETSHQHDLGAEVAPSEVPV 256 S+ GA A V V Sbjct: 539 LPNSNHVASGAGEAEERVVV 558
>6PGD_BUCAI (P57208) 6-phosphogluconate dehydrogenase, decarboxylating (EC| 1.1.1.44) Length = 468 Score = 29.6 bits (65), Expect = 5.1 Identities = 22/68 (32%), Positives = 38/68 (55%), Gaps = 3/68 (4%) Frame = +3 Query: 105 DRCHGRRLSKRSRGIRAP-NLLTARFFA--WSWRKRQAISMIWVLKLPRVKSLLRDCRSR 275 D+ G+ +SK + +R P +L+T FA S KRQ I +L+ P++K+ ++D S Sbjct: 258 DKGTGKWISKSALDLREPLSLITESVFARYLSSLKRQRIIASKILQGPKIKTFIKDKNSF 317 Query: 276 KFRLRKLL 299 +R+ L Sbjct: 318 IEEVRRAL 325 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,494,222 Number of Sequences: 219361 Number of extensions: 936902 Number of successful extensions: 2965 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2900 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2965 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3869946934 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)