| Clone Name | bags12k16 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | STUB_DROME (Q05319) Serine proteinase stubble (EC 3.4.21.-) (Pro... | 31 | 2.1 | 2 | Y1286_METJA (Q58682) Hypothetical protein MJ1286 | 30 | 4.6 | 3 | SAR1_TOBAC (P52885) GTP-binding protein SAR1 | 30 | 6.0 |
|---|
>STUB_DROME (Q05319) Serine proteinase stubble (EC 3.4.21.-) (Protein| stubble-stubbloid) [Contains: Serine proteinase stubble non-catalytic chain; Serine proteinase stubble catalytic chain] Length = 787 Score = 31.2 bits (69), Expect = 2.1 Identities = 22/76 (28%), Positives = 30/76 (39%), Gaps = 7/76 (9%) Frame = -1 Query: 249 PCPAGWVG*GRVG-------SDQGTTSQVALICSRTGASEMSCSSSK*VKGYNTSVI*RW 91 P P GW G V S ++ ++ RT S S +TS+I W Sbjct: 314 PRPTGWTKPGIVNLPMPARPSKPSKPTKKPIVYDRTPPPPPSVPPSTSTSTTSTSLI--W 371 Query: 90 PGQCHQPLPYEPLPPR 43 P Q H P P+ P P+ Sbjct: 372 PAQTHPPQPHRPTRPQ 387
>Y1286_METJA (Q58682) Hypothetical protein MJ1286| Length = 595 Score = 30.0 bits (66), Expect = 4.6 Identities = 11/38 (28%), Positives = 21/38 (55%) Frame = +3 Query: 432 YRPISYLVSAVLGFYLIITHCVCLVLFYKKYNLVGVLY 545 Y P+ +L S +LG + I + +FY + L+G ++ Sbjct: 61 YLPVVFLTSIILGLIIFIIFLIVFNIFYAIFGLIGGIF 98
>SAR1_TOBAC (P52885) GTP-binding protein SAR1| Length = 198 Score = 29.6 bits (65), Expect = 6.0 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +1 Query: 328 LCCVRRKSWR*MMSNQPAAPLKRARV 405 +CC+R+ +WR M A+PL R +V Sbjct: 138 ICCLRKMNWRYHMGANGASPLARGKV 163 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 70,210,078 Number of Sequences: 219361 Number of extensions: 1221640 Number of successful extensions: 3393 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3287 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3392 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4528412720 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)