ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | bags12k07 |
|---|---|
| Clone Library Name | barley_pub |
>NLT41_HORVU (Q43767) Nonspecific lipid-transfer protein 4.1 precursor (LTP 4.1)| (CW21) (CW-21) Length = 115 Score = 71.2 bits (173), Expect = 7e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 113 ISCGQVSSALSPCISYARGNGAKPPAACCSGV 208 ISCGQVSSALSPCISYARGNGAKPPAACCSGV Sbjct: 27 ISCGQVSSALSPCISYARGNGAKPPAACCSGV 58
>NLT43_HORVU (Q42842) Nonspecific lipid-transfer protein 4.3 precursor (LTP 4.3)| Length = 115 Score = 69.7 bits (169), Expect = 2e-12 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +2 Query: 113 ISCGQVSSALSPCISYARGNGAKPPAACCSGV 208 ISCGQVSSALSPCISYARGNGAKPP ACCSGV Sbjct: 27 ISCGQVSSALSPCISYARGNGAKPPVACCSGV 58
>NLT42_HORVU (Q43875) Nonspecific lipid-transfer protein 4.2 precursor (LTP 4.2)| (Low-temperature-responsive protein 4.9) Length = 115 Score = 69.7 bits (169), Expect = 2e-12 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +2 Query: 113 ISCGQVSSALSPCISYARGNGAKPPAACCSGV 208 ISCGQVSSALSPCISYARGNGAKPP ACCSGV Sbjct: 27 ISCGQVSSALSPCISYARGNGAKPPVACCSGV 58
>NLTP3_HORVU (Q43766) Nonspecific lipid-transfer protein 3 precursor (LTP 3)| (CW20) (CW-20) (CW-19) Length = 118 Score = 69.7 bits (169), Expect = 2e-12 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +2 Query: 113 ISCGQVSSALSPCISYARGNGAKPPAACCSGV 208 ISCGQVSSALSPCISYARGNGAKPP ACCSGV Sbjct: 27 ISCGQVSSALSPCISYARGNGAKPPVACCSGV 58
>NLTP_MAIZE (P19656) Nonspecific lipid-transfer protein precursor (LTP)| (Phospholipid transfer protein) (PLTP) (Allergen Zea m 14) Length = 120 Score = 57.4 bits (137), Expect = 1e-08 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = +2 Query: 113 ISCGQVSSALSPCISYARGNGAKPPAACCSGV 208 ISCGQV+SA++PCISYARG G+ P A CCSGV Sbjct: 29 ISCGQVASAIAPCISYARGQGSGPSAGCCSGV 60
>NLTP2_SORBI (Q43194) Nonspecific lipid-transfer protein 2 precursor (LTP 2)| Length = 122 Score = 55.8 bits (133), Expect = 3e-08 Identities = 22/32 (68%), Positives = 27/32 (84%) Frame = +2 Query: 113 ISCGQVSSALSPCISYARGNGAKPPAACCSGV 208 ++CGQVSSA+ PC+SYARG G+ P A CCSGV Sbjct: 31 VTCGQVSSAIGPCLSYARGQGSGPSAGCCSGV 62
>NLTP8_HORVU (Q43871) Nonspecific lipid-transfer protein Cw18 precursor (LTP| Cw-18) (PKG2316) Length = 115 Score = 54.3 bits (129), Expect = 9e-08 Identities = 22/32 (68%), Positives = 26/32 (81%) Frame = +2 Query: 113 ISCGQVSSALSPCISYARGNGAKPPAACCSGV 208 I+CGQVSSAL PC +YA+G+G P A CCSGV Sbjct: 27 ITCGQVSSALGPCAAYAKGSGTSPSAGCCSGV 58
>NLTP2_ORYSA (Q42978) Nonspecific lipid-transfer protein 2 precursor (LTP 2)| Length = 118 Score = 54.3 bits (129), Expect = 9e-08 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +2 Query: 113 ISCGQVSSALSPCISYARGNGAKPPAACCSGV 208 ISCGQV+SA+SPC+SYARG G+ P AACCSGV Sbjct: 28 ISCGQVNSAVSPCLSYARG-GSGPSAACCSGV 58
>NLTP1_SORBI (Q43193) Nonspecific lipid-transfer protein 1 precursor (LTP 1)| Length = 118 Score = 53.1 bits (126), Expect = 2e-07 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = +2 Query: 113 ISCGQVSSALSPCISYARGNGAKPPAACCSGV 208 ISCGQVSSA++ C+SYARG G P A CCSGV Sbjct: 27 ISCGQVSSAIALCLSYARGQGFAPSAGCCSGV 58
>NLTP_ELECO (P23802) Nonspecific lipid-transfer protein (LTP) (Alpha-amylase| inhibitor I-2) Length = 95 Score = 52.8 bits (125), Expect = 2e-07 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = +2 Query: 113 ISCGQVSSALSPCISYARGNGAKPPAACCSGV 208 ISCGQVSSA+ PC++YARG GA P A+C SGV Sbjct: 2 ISCGQVSSAIGPCLAYARGAGAAPSASCQSGV 33
>NLTP1_PRUPE (P81402) Nonspecific lipid-transfer protein 1 (LTP 1) (Major| allergen Pru p 3) (Pru p 1) Length = 91 Score = 52.8 bits (125), Expect = 2e-07 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = +2 Query: 113 ISCGQVSSALSPCISYARGNGAKPPAACCSGV 208 I+CGQVSSAL+PCI Y RG GA PP ACC+G+ Sbjct: 1 ITCGQVSSALAPCIPYVRGGGAVPP-ACCNGI 31
>NLTP3_ORYSA (Q42999) Nonspecific lipid-transfer protein 3 precursor (LTP 3)| Length = 117 Score = 52.4 bits (124), Expect = 3e-07 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = +2 Query: 113 ISCGQVSSALSPCISYARGNGAKPPAACCSGV 208 ISCGQV+SA+SPC+SYAR G +P AACCSGV Sbjct: 28 ISCGQVNSAVSPCLSYAR--GLRPSAACCSGV 57
>NLTP1_PRUAR (P81651) Nonspecific lipid-transfer protein 1 (LTP 1) (Major| allergen Pru ar 3) Length = 91 Score = 52.0 bits (123), Expect = 4e-07 Identities = 22/32 (68%), Positives = 27/32 (84%) Frame = +2 Query: 113 ISCGQVSSALSPCISYARGNGAKPPAACCSGV 208 I+CGQVSS+L+PCI Y RG GA PP ACC+G+ Sbjct: 1 ITCGQVSSSLAPCIGYVRGGGAVPP-ACCNGI 31
>NLTP1_ORYSA (P23096) Nonspecific lipid-transfer protein 1 precursor (LTP 1)| (PAPI) Length = 116 Score = 51.6 bits (122), Expect = 6e-07 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = +2 Query: 113 ISCGQVSSALSPCISYARGNGAKPPAACCSGV 208 I+CGQV+SA+ PC++YARG GA P AACCSGV Sbjct: 26 ITCGQVNSAVGPCLTYARG-GAGPSAACCSGV 56
>NLTP_PRUAV (Q9M5X8) Nonspecific lipid-transfer protein precursor (LTP)| (Allergen Pru av 3) Length = 117 Score = 50.4 bits (119), Expect = 1e-06 Identities = 21/32 (65%), Positives = 27/32 (84%) Frame = +2 Query: 113 ISCGQVSSALSPCISYARGNGAKPPAACCSGV 208 ++CGQVSS L+PCI+Y RG GA PP ACC+G+ Sbjct: 27 LTCGQVSSNLAPCIAYVRGGGAVPP-ACCNGI 57
>NLTP1_PRUDU (Q43017) Nonspecific lipid-transfer protein 1 precursor (LTP 1)| Length = 117 Score = 50.4 bits (119), Expect = 1e-06 Identities = 22/32 (68%), Positives = 26/32 (81%) Frame = +2 Query: 113 ISCGQVSSALSPCISYARGNGAKPPAACCSGV 208 I+CGQVSS L+PCI Y RG GA PP ACC+G+ Sbjct: 27 ITCGQVSSNLAPCIPYVRGGGAVPP-ACCNGI 57
>NLTP1_PRUDO (P82534) Nonspecific lipid-transfer protein 1 (LTP 1) (Major| allergen Pru d 3) Length = 91 Score = 50.1 bits (118), Expect = 2e-06 Identities = 21/32 (65%), Positives = 27/32 (84%) Frame = +2 Query: 113 ISCGQVSSALSPCISYARGNGAKPPAACCSGV 208 I+CGQVSS L+PCI+Y +G GA PP ACC+G+ Sbjct: 1 ITCGQVSSNLAPCINYVKGGGAVPP-ACCNGI 31
>NLTP_HELAN (Q39950) Nonspecific lipid-transfer protein precursor (LTP) (NsLTP)| (SDI-9) Length = 116 Score = 49.7 bits (117), Expect = 2e-06 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = +2 Query: 113 ISCGQVSSALSPCISYARGNGAKPPAACCSGV 208 +SCGQVSS+L+PCISY GA PP ACCSGV Sbjct: 26 LSCGQVSSSLAPCISYLTKGGAVPP-ACCSGV 56
>NLTP_MALDO (Q9M5X7) Nonspecific lipid-transfer protein precursor (LTP)| (Allergen Mal d 3) Length = 115 Score = 48.5 bits (114), Expect = 5e-06 Identities = 20/32 (62%), Positives = 26/32 (81%) Frame = +2 Query: 113 ISCGQVSSALSPCISYARGNGAKPPAACCSGV 208 I+CGQV+S+L+PCI Y R GA PP ACC+G+ Sbjct: 25 ITCGQVTSSLAPCIGYVRSGGAVPP-ACCNGI 55
>NLTP4_ORYSA (Q42976) Nonspecific lipid-transfer protein 4 precursor (LTP 4)| Length = 121 Score = 46.2 bits (108), Expect = 2e-05 Identities = 16/32 (50%), Positives = 25/32 (78%) Frame = +2 Query: 113 ISCGQVSSALSPCISYARGNGAKPPAACCSGV 208 +SCG V+S+++PC+SY G + P ++CCSGV Sbjct: 30 VSCGDVTSSIAPCLSYVMGRESSPSSSCCSGV 61
>NLTP_PYRCO (Q9M5X6) Nonspecific lipid-transfer protein precursor (LTP)| (Allergen Pyr c 3) Length = 115 Score = 45.4 bits (106), Expect = 4e-05 Identities = 19/32 (59%), Positives = 25/32 (78%) Frame = +2 Query: 113 ISCGQVSSALSPCISYARGNGAKPPAACCSGV 208 I+C QVS+ L+PCI+Y R GA PP ACC+G+ Sbjct: 25 ITCSQVSANLAPCINYVRSGGAVPP-ACCNGI 55
>NLTPB_WHEAT (P26913) Probable nonspecific lipid-transfer protein (LTP) (Basic| protein) (WBP) (Fragment) Length = 40 Score = 44.7 bits (104), Expect = 7e-05 Identities = 19/31 (61%), Positives = 22/31 (70%) Frame = +2 Query: 116 SCGQVSSALSPCISYARGNGAKPPAACCSGV 208 +CGQV S L+PCISYA G + P CCSGV Sbjct: 4 NCGQVVSYLAPCISYAMGRVSAPGGGCCSGV 34
>NLTP4_VITSX (P80274) Nonspecific lipid-transfer protein P4 (LTP P4) (Fragment)| Length = 37 Score = 44.7 bits (104), Expect = 7e-05 Identities = 17/29 (58%), Positives = 23/29 (79%) Frame = +2 Query: 113 ISCGQVSSALSPCISYARGNGAKPPAACC 199 ++CGQV+SALSPCI Y + +GA P +CC Sbjct: 2 VTCGQVASALSPCIDYLQKDGAVPAGSCC 30
>NLTP5_ORYSA (O65091) Nonspecific lipid-transfer protein 5 precursor (LTP 5)| Length = 117 Score = 43.9 bits (102), Expect = 1e-04 Identities = 17/32 (53%), Positives = 20/32 (62%) Frame = +2 Query: 113 ISCGQVSSALSPCISYARGNGAKPPAACCSGV 208 ++CGQV S +PCI YA G G P CC GV Sbjct: 26 VTCGQVVSTWAPCIMYADGEGVAPTGGCCDGV 57
>NLTP_PINTA (Q41073) Nonspecific lipid-transfer protein precursor (LTP)| Length = 123 Score = 42.7 bits (99), Expect = 3e-04 Identities = 17/32 (53%), Positives = 21/32 (65%) Frame = +2 Query: 113 ISCGQVSSALSPCISYARGNGAKPPAACCSGV 208 ISC QV SA++PC +Y GN A P A CC + Sbjct: 32 ISCNQVVSAMTPCATYLIGNAATPAATCCPSI 63
>NLTP_GERHY (Q39794) Nonspecific lipid-transfer protein precursor (LTP)| Length = 116 Score = 42.4 bits (98), Expect = 3e-04 Identities = 19/32 (59%), Positives = 21/32 (65%) Frame = +2 Query: 113 ISCGQVSSALSPCISYARGNGAKPPAACCSGV 208 ISCGQV+S L PC Y G PP ACC+GV Sbjct: 26 ISCGQVTSGLVPCFGYLAAGGPVPP-ACCNGV 56
>NLTP2_VITSX (P33556) Nonspecific lipid-transfer protein P2 (LTP P2) (Fragment)| Length = 38 Score = 42.4 bits (98), Expect = 3e-04 Identities = 17/29 (58%), Positives = 21/29 (72%) Frame = +2 Query: 113 ISCGQVSSALSPCISYARGNGAKPPAACC 199 I+CGQVSSALS C+ Y + GA PP + C Sbjct: 2 ITCGQVSSALSSCLGYLKNGGAVPPGSSC 30
>NLTP1_VITSX (P80275) Nonspecific lipid-transfer protein P1 (LTP P1) (Fragment)| Length = 38 Score = 42.4 bits (98), Expect = 3e-04 Identities = 17/29 (58%), Positives = 21/29 (72%) Frame = +2 Query: 113 ISCGQVSSALSPCISYARGNGAKPPAACC 199 I+CGQVSSALS C+ Y + GA PP + C Sbjct: 2 ITCGQVSSALSSCLGYLKNGGAVPPGSSC 30
>NLTP_AMACA (P80450) Nonspecific lipid-transfer protein (LTP) (Phospholipid| transfer protein) (PLTP) Length = 94 Score = 42.0 bits (97), Expect = 4e-04 Identities = 17/33 (51%), Positives = 24/33 (72%), Gaps = 1/33 (3%) Frame = +2 Query: 113 ISCGQVSSALSPCISYARGNGAKPPAA-CCSGV 208 ++C V+ AL PC++Y +G GA PP A CC+GV Sbjct: 2 VTCTVVTKALGPCMTYLKGTGATPPPANCCAGV 34
>NLTP1_AMAHP (P83167) Nonspecific lipid-transfer protein 1 (LTP 1) (NS-LTP1)| Length = 94 Score = 42.0 bits (97), Expect = 4e-04 Identities = 17/33 (51%), Positives = 24/33 (72%), Gaps = 1/33 (3%) Frame = +2 Query: 113 ISCGQVSSALSPCISYARGNGAKPPAA-CCSGV 208 ++C V+ AL PC++Y +G GA PP A CC+GV Sbjct: 2 VTCTVVTKALGPCMTYLKGTGATPPPANCCAGV 34
>NLTPA_RICCO (P10973) Nonspecific lipid-transfer protein A (NS-LTP A)| (Phospholipid transfer protein) (PLTP) Length = 92 Score = 42.0 bits (97), Expect = 4e-04 Identities = 16/32 (50%), Positives = 23/32 (71%) Frame = +2 Query: 113 ISCGQVSSALSPCISYARGNGAKPPAACCSGV 208 + CGQV+S+L+ CI + G A P A+CC+GV Sbjct: 1 VDCGQVNSSLASCIPFLTGGVASPSASCCAGV 32
>NLTPD_BRAOT (Q43304) Nonspecific lipid-transfer protein D precursor (LTP D)| (Wax-associated protein 9D) Length = 118 Score = 41.6 bits (96), Expect = 6e-04 Identities = 17/32 (53%), Positives = 20/32 (62%) Frame = +2 Query: 113 ISCGQVSSALSPCISYARGNGAKPPAACCSGV 208 +SCG VS ++PCI Y N P ACCSGV Sbjct: 27 LSCGTVSGYVAPCIGYLAQNAPAVPTACCSGV 58
>NLTP2_TOBAC (Q03461) Nonspecific lipid-transfer protein 2 precursor (LTP 2)| Length = 114 Score = 41.2 bits (95), Expect = 7e-04 Identities = 17/32 (53%), Positives = 22/32 (68%) Frame = +2 Query: 113 ISCGQVSSALSPCISYARGNGAKPPAACCSGV 208 +SCGQV S L+PC+ Y +G G P +CC GV Sbjct: 25 LSCGQVQSGLAPCLPYLQGRG--PLGSCCGGV 54
>NLTP_CICAR (O23758) Nonspecific lipid-transfer protein precursor (LTP)| Length = 116 Score = 40.8 bits (94), Expect = 0.001 Identities = 17/32 (53%), Positives = 23/32 (71%) Frame = +2 Query: 113 ISCGQVSSALSPCISYARGNGAKPPAACCSGV 208 I+CG+V +AL+PC+ Y +G G P A CC GV Sbjct: 25 ITCGRVDTALAPCLGYLQG-GPGPSAQCCGGV 55
>NLTP1_GOSHI (Q42762) Nonspecific lipid-transfer protein precursor (LTP)| Length = 116 Score = 40.8 bits (94), Expect = 0.001 Identities = 16/33 (48%), Positives = 26/33 (78%), Gaps = 1/33 (3%) Frame = +2 Query: 113 ISCGQVSSALSPCISYARGNGA-KPPAACCSGV 208 ++ GQV+++L+PCI+Y RG+GA P CC+G+ Sbjct: 24 VTSGQVTNSLAPCINYLRGSGAGAVPPGCCTGI 56
>SCA_LILLO (Q9SW93) Stigma/stylar cysteine-rich adhesin precursor (Lipid| transfer protein) Length = 113 Score = 40.8 bits (94), Expect = 0.001 Identities = 18/32 (56%), Positives = 22/32 (68%) Frame = +2 Query: 113 ISCGQVSSALSPCISYARGNGAKPPAACCSGV 208 I+CGQV S L+ C+ YAR G PP CC+GV Sbjct: 23 ITCGQVDSDLTSCLGYARKGGVIPP-GCCAGV 53
>NLTP2_GOSHI (Q43129) Nonspecific lipid-transfer protein precursor (LTP) (GH3)| Length = 120 Score = 40.8 bits (94), Expect = 0.001 Identities = 16/33 (48%), Positives = 26/33 (78%), Gaps = 1/33 (3%) Frame = +2 Query: 113 ISCGQVSSALSPCISYARGNGA-KPPAACCSGV 208 ++ GQV+++L+PCI+Y RG+GA P CC+G+ Sbjct: 28 VTSGQVTNSLAPCINYLRGSGAGAVPPGCCTGI 60
>NLTP3_VITSX (P80273) Nonspecific lipid-transfer protein P3 (LTP P3) (Fragment)| Length = 37 Score = 40.0 bits (92), Expect = 0.002 Identities = 17/32 (53%), Positives = 24/32 (75%) Frame = +2 Query: 113 ISCGQVSSALSPCISYARGNGAKPPAACCSGV 208 +SCG V++ ++ CI+Y RG G PAACC+GV Sbjct: 1 LSCGDVATQMASCINYLRGAGPL-PAACCNGV 31
>NLTP4_ARATH (Q9LLR6) Nonspecific lipid-transfer protein 4 precursor (LTP 4)| Length = 112 Score = 40.0 bits (92), Expect = 0.002 Identities = 17/32 (53%), Positives = 22/32 (68%) Frame = +2 Query: 113 ISCGQVSSALSPCISYARGNGAKPPAACCSGV 208 I+CG V+S+LSPC+ Y G PP CC+GV Sbjct: 25 ITCGTVASSLSPCLGYLSKGGVVPP-PCCAGV 55
>NLTP3_PRUDU (Q43019) Nonspecific lipid-transfer protein 3 precursor (LTP 3)| Length = 123 Score = 39.7 bits (91), Expect = 0.002 Identities = 17/32 (53%), Positives = 23/32 (71%) Frame = +2 Query: 113 ISCGQVSSALSPCISYARGNGAKPPAACCSGV 208 +SCGQV + L+PCI+Y GA P +CC+GV Sbjct: 31 VSCGQVVNNLTPCINYVANGGALNP-SCCTGV 61
>NLTP1_TOBAC (Q42952) Nonspecific lipid-transfer protein 1 precursor (LTP 1)| (Pathogenesis-related protein 14) (PR-14) Length = 114 Score = 39.7 bits (91), Expect = 0.002 Identities = 17/32 (53%), Positives = 22/32 (68%) Frame = +2 Query: 113 ISCGQVSSALSPCISYARGNGAKPPAACCSGV 208 I+CGQV+S L+PC++Y R G P CC GV Sbjct: 25 ITCGQVTSNLAPCLAYLRNTG--PLGRCCGGV 54
>NLTP1_LYCES (P93224) Nonspecific lipid-transfer protein 1 precursor (LTP 1)| Length = 114 Score = 39.7 bits (91), Expect = 0.002 Identities = 16/32 (50%), Positives = 21/32 (65%) Frame = +2 Query: 113 ISCGQVSSALSPCISYARGNGAKPPAACCSGV 208 +SCG+V+S L+PC+ Y G G P CC GV Sbjct: 25 LSCGEVTSGLAPCLPYLEGRG--PLGGCCGGV 54
>NLTP_STRHE (O65888) Nonspecific lipid-transfer protein precursor (LTP)| (Fragment) Length = 118 Score = 39.7 bits (91), Expect = 0.002 Identities = 16/32 (50%), Positives = 20/32 (62%) Frame = +2 Query: 113 ISCGQVSSALSPCISYARGNGAKPPAACCSGV 208 + CG V + CIS+A G KP AACCSG+ Sbjct: 8 LPCGTVDMKAASCISFATGKDKKPSAACCSGL 39
>NLTP_BETVU (Q43748) Nonspecific lipid-transfer protein precursor (LTP)| Length = 117 Score = 39.3 bits (90), Expect = 0.003 Identities = 17/32 (53%), Positives = 22/32 (68%) Frame = +2 Query: 113 ISCGQVSSALSPCISYARGNGAKPPAACCSGV 208 I+CG V+S L+PCI Y +G P AACC G+ Sbjct: 27 ITCGLVASKLAPCIGYLQG-APGPSAACCGGI 57
>NLTP1_HORVU (P07597) Nonspecific lipid-transfer protein 1 precursor (LTP 1)| (Probable amylase/protease inhibitor) Length = 117 Score = 39.3 bits (90), Expect = 0.003 Identities = 15/32 (46%), Positives = 22/32 (68%) Frame = +2 Query: 113 ISCGQVSSALSPCISYARGNGAKPPAACCSGV 208 ++CGQV S + PC++Y +G G P CC+GV Sbjct: 27 LNCGQVDSKMKPCLTYVQG-GPGPSGECCNGV 57
>NLTP2_LYCES (P27056) Nonspecific lipid-transfer protein 2 precursor (LTP 2)| Length = 114 Score = 38.9 bits (89), Expect = 0.004 Identities = 15/32 (46%), Positives = 22/32 (68%) Frame = +2 Query: 113 ISCGQVSSALSPCISYARGNGAKPPAACCSGV 208 ++CGQV++ L+PC+ Y +G G P CC GV Sbjct: 25 LTCGQVTAGLAPCLPYLQGRG--PLGGCCGGV 54
>NLTP1_ARATH (Q42589) Nonspecific lipid-transfer protein 1 precursor (LTP 1)| Length = 118 Score = 38.9 bits (89), Expect = 0.004 Identities = 18/32 (56%), Positives = 21/32 (65%) Frame = +2 Query: 113 ISCGQVSSALSPCISYARGNGAKPPAACCSGV 208 +SCG V+S L+ CI Y G PP ACCSGV Sbjct: 27 LSCGSVNSNLAACIGYVLQGGVIPP-ACCSGV 57
>NLTP3_ARATH (Q9LLR7) Nonspecific lipid-transfer protein 3 precursor (LTP 3)| Length = 115 Score = 38.1 bits (87), Expect = 0.006 Identities = 16/32 (50%), Positives = 22/32 (68%) Frame = +2 Query: 113 ISCGQVSSALSPCISYARGNGAKPPAACCSGV 208 ISCG V+ +L+PC +Y G PP +CC+GV Sbjct: 25 ISCGTVAGSLAPCATYLSKGGLVPP-SCCAGV 55
>NLTP_ARTVU (P0C088) Nonspecific lipid-transfer protein (LTP) (Pollen allergen| Art v 3) (Fragment) Length = 37 Score = 38.1 bits (87), Expect = 0.006 Identities = 15/32 (46%), Positives = 23/32 (71%) Frame = +2 Query: 113 ISCGQVSSALSPCISYARGNGAKPPAACCSGV 208 ++C VS+ +SPC+SY + G + PA CC+GV Sbjct: 2 LTCSDVSNKISPCLSYLK-QGGEVPADCCAGV 32
>NLTPB_RICCO (P10974) Nonspecific lipid-transfer protein B (NS-LTP B)| (Phospholipid transfer protein) (PLTP) Length = 92 Score = 38.1 bits (87), Expect = 0.006 Identities = 14/32 (43%), Positives = 20/32 (62%) Frame = +2 Query: 113 ISCGQVSSALSPCISYARGNGAKPPAACCSGV 208 ++CGQV+ ALS C+ + G P CC+GV Sbjct: 1 VNCGQVNKALSSCVPFLTGFDTTPSLTCCAGV 32
>NLTP1_WHEAT (P24296) Nonspecific lipid-transfer protein precursor (LTP)| (Phospholipid transfer protein) (PLTP) (ns-LTP1) (Fragment) Length = 113 Score = 37.7 bits (86), Expect = 0.008 Identities = 16/32 (50%), Positives = 19/32 (59%) Frame = +2 Query: 113 ISCGQVSSALSPCISYARGNGAKPPAACCSGV 208 I CG V S + PC+SY +G G P CC GV Sbjct: 24 IDCGHVDSLVRPCLSYVQG-GPGPSGQCCDGV 54
>NLTP3_BRANA (Q42616) Nonspecific lipid-transfer protein 3 precursor (LTP 3)| Length = 117 Score = 37.7 bits (86), Expect = 0.008 Identities = 18/32 (56%), Positives = 20/32 (62%) Frame = +2 Query: 113 ISCGQVSSALSPCISYARGNGAKPPAACCSGV 208 +SCG VS L+ CI Y NG P ACCSGV Sbjct: 27 LSCGTVSGNLAACIGYLTQNG-PVPTACCSGV 57
>NLTP6_GOSHI (O24418) Nonspecific lipid-transfer protein 6 precursor (LTP)| Length = 120 Score = 37.4 bits (85), Expect = 0.011 Identities = 17/33 (51%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Frame = +2 Query: 113 ISCGQVSSALSPCISYARGNGAKP-PAACCSGV 208 IS QV S+L PC+ Y RGN A+P P C G+ Sbjct: 28 ISYDQVKSSLLPCVGYVRGNNARPAPPNYCKGI 60
>NLTP2_BRANA (Q42615) Nonspecific lipid-transfer protein 2 precursor (LTP 2)| Length = 117 Score = 36.6 bits (83), Expect = 0.018 Identities = 16/32 (50%), Positives = 20/32 (62%) Frame = +2 Query: 113 ISCGQVSSALSPCISYARGNGAKPPAACCSGV 208 +SCG VS ++PCI Y NG P CC+GV Sbjct: 27 LSCGTVSGYVAPCIGYLTQNGPL-PRGCCTGV 57
>NLT13_PARJU (Q40905) Probable nonspecific lipid-transfer protein 1 precursor| (LTP) (Major pollen allergen Par j 1.0201) (Par j I) (P1 protein) Length = 138 Score = 36.2 bits (82), Expect = 0.024 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +2 Query: 116 SCGQVSSALSPCISYARGNGAKPPAACCSG 205 +CG V AL PC+ + +G +P CCSG Sbjct: 39 TCGTVVGALMPCLPFVQGKEKEPSKGCCSG 68
>NLT12_PARJU (O04404) Probable nonspecific lipid-transfer protein 1 precursor| (LTP) (Major pollen allergen Par j 1.0102) (Par j I) (P9 protein) Length = 176 Score = 35.8 bits (81), Expect = 0.031 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +2 Query: 116 SCGQVSSALSPCISYARGNGAKPPAACCSG 205 +CG V AL PC+ + +G +P CCSG Sbjct: 40 TCGTVVRALMPCLPFVQGKEKEPSKGCCSG 69
>NLTPA_BRAOT (Q42641) Nonspecific lipid-transfer protein A precursor (LTP A)| (Wax-associated protein 9A) Length = 118 Score = 35.8 bits (81), Expect = 0.031 Identities = 15/32 (46%), Positives = 21/32 (65%) Frame = +2 Query: 113 ISCGQVSSALSPCISYARGNGAKPPAACCSGV 208 ++CG V+S ++PCI Y G P ACC+GV Sbjct: 27 LTCGTVNSNVAPCIGYIT-QGGTLPGACCTGV 57
>NLTP_DAUCA (P27631) Nonspecific lipid-transfer protein precursor (LTP)| (Extracellular protein 2) Length = 120 Score = 35.4 bits (80), Expect = 0.041 Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Frame = +2 Query: 113 ISCGQVSSALSPCISYARGNGAKP-PAACCSGV 208 ++CGQV+ AL+PC+ Y R P P CC+ V Sbjct: 28 LTCGQVTGALAPCLGYLRSQVNVPVPLTCCNVV 60
>NLTP_SPIOL (P10976) Nonspecific lipid-transfer protein precursor (LTP)| (Phospholipid transfer protein) (PLTP) Length = 117 Score = 35.0 bits (79), Expect = 0.053 Identities = 15/32 (46%), Positives = 19/32 (59%) Frame = +2 Query: 113 ISCGQVSSALSPCISYARGNGAKPPAACCSGV 208 I+CG VSS L+PCI Y +G CC G+ Sbjct: 28 ITCGMVSSKLAPCIGYLKGGPL--GGGCCGGI 57
>NLT11_PARJU (P43217) Probable nonspecific lipid-transfer protein (LTP) (Major| pollen allergen Par j 1.0101) (Par j I) (P5 protein) (Fragment) Length = 139 Score = 34.7 bits (78), Expect = 0.070 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +2 Query: 116 SCGQVSSALSPCISYARGNGAKPPAACCSG 205 +CG + AL PC+ + +G +P CCSG Sbjct: 3 TCGTMVRALMPCLPFVQGKEKEPSKGCCSG 32
>NLTPB_BRAOT (Q42642) Nonspecific lipid-transfer protein B precursor (LTP B)| (Wax-associated protein 9B) Length = 117 Score = 34.7 bits (78), Expect = 0.070 Identities = 16/32 (50%), Positives = 19/32 (59%) Frame = +2 Query: 113 ISCGQVSSALSPCISYARGNGAKPPAACCSGV 208 +SCG VS L+ CI Y NG P CC+GV Sbjct: 27 LSCGTVSGNLAACIGYLTQNGPL-PRGCCTGV 57
>NLTP1_BRANA (Q42614) Nonspecific lipid-transfer protein 1 precursor (LTP 1)| Length = 117 Score = 34.7 bits (78), Expect = 0.070 Identities = 16/32 (50%), Positives = 19/32 (59%) Frame = +2 Query: 113 ISCGQVSSALSPCISYARGNGAKPPAACCSGV 208 +SCG VS L+ CI Y NG P CC+GV Sbjct: 27 LSCGTVSGNLAACIGYLTQNGPL-PRGCCTGV 57
>NLTP1_PHAAU (P83434) Nonspecific lipid-transfer protein 1 (LTP 1) (NS-LTP1)| Length = 91 Score = 34.7 bits (78), Expect = 0.070 Identities = 14/32 (43%), Positives = 21/32 (65%) Frame = +2 Query: 113 ISCGQVSSALSPCISYARGNGAKPPAACCSGV 208 ++CGQV L+ CI + + G PP +CC+GV Sbjct: 1 MTCGQVQGNLAQCIGFLQKGGVVPP-SCCTGV 31
>NLTPD_RICCO (Q43119) Nonspecific lipid-transfer protein D, cotyledon-specific| isoform precursor (NS-LTP D) Length = 116 Score = 34.3 bits (77), Expect = 0.091 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +2 Query: 113 ISCGQVSSALSPCISYARGNGAKPPAACCSGV 208 + C V + C+ +A G +KP +ACC+G+ Sbjct: 26 VPCSTVDMKAAACVGFATGKDSKPSSACCTGL 57
>NLT22_PARJU (O04403) Probable nonspecific lipid-transfer protein 2 precursor| (LTP 2) (Major pollen allergen Par j 2.0102) (Par j II) (P8 protein) Length = 133 Score = 34.3 bits (77), Expect = 0.091 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +2 Query: 119 CGQVSSALSPCISYARGNGAKPPAACCSG 205 CG+V + PC+ + +G +P +CCSG Sbjct: 35 CGKVVHHIMPCLKFVKGEEKEPSKSCCSG 63
>NLT21_PARJU (P55958) Probable nonspecific lipid-transfer protein 2 precursor| (LTP 2) (Major pollen allergen Par j 2.0101) (Par j II) (P2 protein) Length = 133 Score = 33.9 bits (76), Expect = 0.12 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = +2 Query: 116 SCGQVSSALSPCISYARGNGAKPPAACCSG 205 +CG+V + PC+ + +G +P CCSG Sbjct: 34 ACGKVVQDIMPCLHFVKGEEKEPSKECCSG 63
>NLTPC_RICCO (P10975) Nonspecific lipid-transfer protein C, cotyledon-specific| isoform precursor (NS-LTP C) (Phospholipid transfer protein) (PLTP) Length = 116 Score = 33.5 bits (75), Expect = 0.16 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +2 Query: 113 ISCGQVSSALSPCISYARGNGAKPPAACCSGV 208 + C V + C+ +A G +KP ACC+G+ Sbjct: 26 VPCSTVDMKAAACVGFATGKDSKPSQACCTGL 57
>NLTP6_ARATH (Q9LDB4) Nonspecific lipid-transfer protein 6 precursor (LTP 6)| Length = 113 Score = 31.2 bits (69), Expect = 0.77 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +2 Query: 113 ISCGQVSSALSPCISYARGNGAKPPAACCSGV 208 +SC V + L PC+SY G P CC+G+ Sbjct: 21 VSCNTVIADLYPCLSYVT-QGGPVPTLCCNGL 51
>NLTP_RAPSA (P29420) Seed nonspecific lipid transfer protein-like (LTP)| (Fragment) Length = 43 Score = 30.8 bits (68), Expect = 1.0 Identities = 15/32 (46%), Positives = 19/32 (59%) Frame = +2 Query: 113 ISCGQVSSALSPCISYARGNGAKPPAACCSGV 208 +SCG V+S L+ CI Y N A CC+GV Sbjct: 2 LSCGTVNSNLAACIGYLTQN-APLARGCCTGV 32
>AFP5_MALPA (P83139) Antifungal protein 5 (CW-5) (Fragment)| Length = 38 Score = 30.8 bits (68), Expect = 1.0 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = +2 Query: 113 ISCGQVSSALSPCISYARGNGAKPP 187 I+CGQV+S ++ C+SY + GA P Sbjct: 1 ITCGQVTSQVAGCLSYLQRGGAPAP 25
>NLTP6_AMBAR (O04004) Nonspecific lipid-transfer protein precursor (LTP) (Pollen| allergen Amb a 6) (Amb a VI) (Allergen Ra6) Length = 118 Score = 29.6 bits (65), Expect = 2.2 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +2 Query: 116 SCGQVSSALSPCISYARGNGAKPPAACCSGV 208 +C V + L+PC + G +P ACC+GV Sbjct: 29 TCDTVQNILAPCAGFLTGQ--EPSKACCTGV 57
>NLTP2_ARATH (Q9S7I3) Nonspecific lipid-transfer protein 2 precursor (LTP 2)| Length = 118 Score = 29.6 bits (65), Expect = 2.2 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = +2 Query: 113 ISCGQVSSALSPCISYARGNGAKPPAACCSGV 208 +SCG V+ L+ CI+Y GA CC+GV Sbjct: 27 MSCGTVNGNLAGCIAYLT-RGAPLTQGCCNGV 57
>NLTP_PINPI (P26912) Probable nonspecific lipid-transfer protein (LTP) (Basic| protein) (PBP) (Fragment) Length = 36 Score = 28.9 bits (63), Expect = 3.8 Identities = 11/32 (34%), Positives = 13/32 (40%) Frame = +2 Query: 113 ISCGQVSSALSPCISYARGNGAKPPAACCSGV 208 + C V S L C+ Y P CC GV Sbjct: 2 VDCNTVKSDLVGCVGYLPSGTGNPTPQCCDGV 33 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,185,492 Number of Sequences: 219361 Number of extensions: 146049 Number of successful extensions: 685 Number of sequences better than 10.0: 73 Number of HSP's better than 10.0 without gapping: 616 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 662 length of database: 80,573,946 effective HSP length: 45 effective length of database: 70,702,701 effective search space used: 1696864824 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
