| Clone Name | bags12k04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ZN706_MOUSE (Q9D115) Zinc finger protein 706 | 28 | 9.6 | 2 | ZN706_HUMAN (Q9Y5V0) Zinc finger protein 706 | 28 | 9.6 |
|---|
>ZN706_MOUSE (Q9D115) Zinc finger protein 706| Length = 76 Score = 28.5 bits (62), Expect = 9.6 Identities = 19/68 (27%), Positives = 29/68 (42%), Gaps = 4/68 (5%) Frame = +3 Query: 21 RSXSPXMARERNLEKLKGGKGSQ----LEANKKAMNIQCKICMQTFICTTSEAKCKEHAE 188 R ++++N +K G K Q A K A+ C +C K+H E Sbjct: 3 RGQQKIQSQQKNAKKQAGQKKKQGHDQKAAAKAALIYTCTVCRTQM---PDPKTFKQHFE 59 Query: 189 AKHPKSDL 212 +KHPK+ L Sbjct: 60 SKHPKTPL 67
>ZN706_HUMAN (Q9Y5V0) Zinc finger protein 706| Length = 76 Score = 28.5 bits (62), Expect = 9.6 Identities = 19/68 (27%), Positives = 29/68 (42%), Gaps = 4/68 (5%) Frame = +3 Query: 21 RSXSPXMARERNLEKLKGGKGSQ----LEANKKAMNIQCKICMQTFICTTSEAKCKEHAE 188 R ++++N +K G K Q A K A+ C +C K+H E Sbjct: 3 RGQQKIQSQQKNAKKQAGQKKKQGHDQKAAAKAALIYTCTVCRTQM---PDPKTFKQHFE 59 Query: 189 AKHPKSDL 212 +KHPK+ L Sbjct: 60 SKHPKTPL 67 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 57,641,816 Number of Sequences: 219361 Number of extensions: 942704 Number of successful extensions: 2776 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2685 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2775 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3246866728 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)