| Clone Name | rbaal9h22 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | FTSK_RHILO (Q98EH3) DNA translocase ftsK | 29 | 6.3 | 2 | GLMM_ANASP (Q8YVS4) Phosphoglucosamine mutase (EC 5.4.2.10) | 29 | 8.2 | 3 | CHD6_HUMAN (Q8TD26) Chromodomain-helicase-DNA-binding protein 6 ... | 29 | 8.2 |
|---|
>FTSK_RHILO (Q98EH3) DNA translocase ftsK| Length = 887 Score = 29.3 bits (64), Expect = 6.3 Identities = 16/38 (42%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = -3 Query: 445 DVLFSDDQMQDWSDDA*AQRTDAPHTRV-DIRHDTATR 335 D+ DD+ D+ D+ AQR AP +V R D ATR Sbjct: 313 DIFDRDDEDMDFDDEPVAQRRAAPAAKVQQFRSDAATR 350
>GLMM_ANASP (Q8YVS4) Phosphoglucosamine mutase (EC 5.4.2.10)| Length = 490 Score = 28.9 bits (63), Expect = 8.2 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = -2 Query: 254 APSLLRLQVVPCFFRDGCHGSGAELCSSGVSLPL 153 APSL+ L P F DG G EL S+ ++L + Sbjct: 31 APSLISLPATPLFGTDGIRGKVGELLSAPLALQI 64
>CHD6_HUMAN (Q8TD26) Chromodomain-helicase-DNA-binding protein 6 (EC 3.6.1.-)| (ATP-dependent helicase CHD6) (CHD-6) (Radiation-induced gene B protein) Length = 2715 Score = 28.9 bits (63), Expect = 8.2 Identities = 17/50 (34%), Positives = 21/50 (42%) Frame = +1 Query: 115 HMQITTLQSQKTLKGKETPDEQSSAPEPWHPSLKKQGTTCSRSSDGAWKC 264 H +I L+SQK K K D +S PEP +C R G C Sbjct: 2644 HSEIVGLESQKRKKKKTKGDNPNSHPEP--------APSCEREPSGDENC 2685 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,043,068 Number of Sequences: 219361 Number of extensions: 873849 Number of successful extensions: 2676 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2572 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2676 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3638905326 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)