| Clone Name | bags11p16 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | BFAR_HUMAN (Q9NZS9) Bifunctional apoptosis regulator (RING finge... | 31 | 2.5 | 2 | BFAR_RAT (Q5PQN2) Bifunctional apoptosis regulator | 31 | 3.3 | 3 | BFAR_MOUSE (Q8R079) Bifunctional apoptosis regulator | 30 | 4.2 | 4 | GALT_CLOAB (Q97EZ4) Galactose-1-phosphate uridylyltransferase (E... | 30 | 5.6 |
|---|
>BFAR_HUMAN (Q9NZS9) Bifunctional apoptosis regulator (RING finger protein 47)| Length = 450 Score = 31.2 bits (69), Expect = 2.5 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = -1 Query: 219 INPGGSLLLLKICSSSFKLQFFILY*FYYIDAF 121 +NPG SL LL SS +L LY F Y D F Sbjct: 263 VNPGRSLFLLYALKSSPRLSLLYLYLFDYTDTF 295
>BFAR_RAT (Q5PQN2) Bifunctional apoptosis regulator| Length = 450 Score = 30.8 bits (68), Expect = 3.3 Identities = 16/33 (48%), Positives = 19/33 (57%) Frame = -1 Query: 219 INPGGSLLLLKICSSSFKLQFFILY*FYYIDAF 121 +NPG SL LL SS +L LY F Y D+F Sbjct: 263 VNPGRSLFLLYALKSSPRLGLLYLYLFDYTDSF 295
>BFAR_MOUSE (Q8R079) Bifunctional apoptosis regulator| Length = 450 Score = 30.4 bits (67), Expect = 4.2 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = -1 Query: 219 INPGGSLLLLKICSSSFKLQFFILY*FYYIDAF 121 +NPG SL LL SS +L LY F Y D F Sbjct: 263 VNPGRSLFLLYALKSSPRLGLLYLYLFDYTDCF 295
>GALT_CLOAB (Q97EZ4) Galactose-1-phosphate uridylyltransferase (EC 2.7.7.12)| (Gal-1-P uridylyltransferase) (UDP-glucose--hexose-1-phosphate uridylyltransferase) Length = 497 Score = 30.0 bits (66), Expect = 5.6 Identities = 26/90 (28%), Positives = 42/90 (46%), Gaps = 8/90 (8%) Frame = -1 Query: 459 ISRANIYSFLSYLLIYKLTK*DNFFGLFRHPTQ*SVRIL---FNKILW-----NHRFCRS 304 I++A + SY + + F+G HP + ++RI+ NK W + + Sbjct: 159 IAKAKLSKSTSYPKCLLCKENEGFYGNINHPARQTLRIIPLELNKSKWFLQYSPYTYYNE 218 Query: 303 HCFSLNG*V*IPQRSFQKISFRVNFLSFIN 214 HC LN IP + +I+F N LSFI+ Sbjct: 219 HCIILNN-EHIPMK-ISRITFE-NLLSFID 245 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 72,228,740 Number of Sequences: 219361 Number of extensions: 1340411 Number of successful extensions: 2506 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2489 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2506 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5481822624 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)