| Clone Name | bags12e18 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ZN297_CANFA (Q5TJE2) Zinc finger protein 297 | 28 | 5.3 | 2 | ZN297_HUMAN (O15209) Zinc finger protein 297 (BING1 protein) (Zi... | 28 | 5.3 | 3 | SLAP1_CLOTM (Q06852) Cell surface glycoprotein 1 precursor (Oute... | 28 | 5.3 | 4 | ZN297_MOUSE (Q9Z0G7) Zinc finger protein 297 (BING1 protein) | 28 | 9.0 | 5 | FIG2_YEAST (P25653) Factor-induced gene 2 precursor (Cell wall a... | 28 | 9.0 |
|---|
>ZN297_CANFA (Q5TJE2) Zinc finger protein 297| Length = 640 Score = 28.5 bits (62), Expect = 5.3 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = -2 Query: 103 EPASRTPSSSAEPRARSIATTPIPLPTTS 17 EP+ +PS +A P S+A P+PLP + Sbjct: 2 EPSPLSPSGAALPLPLSLAPPPLPLPAAA 30
>ZN297_HUMAN (O15209) Zinc finger protein 297 (BING1 protein) (Zinc finger and| BTB domain-containing protein 22A) Length = 634 Score = 28.5 bits (62), Expect = 5.3 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = -2 Query: 103 EPASRTPSSSAEPRARSIATTPIPLPTTS 17 EP+ +PS +A P S+A P+PLP + Sbjct: 2 EPSPLSPSGAALPLPLSLAPPPLPLPAAA 30
>SLAP1_CLOTM (Q06852) Cell surface glycoprotein 1 precursor (Outer layer protein| B) (S-layer protein 1) Length = 1664 Score = 28.5 bits (62), Expect = 5.3 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -2 Query: 94 SRTPSSSAEPRARSIATTPIPLPTTSPRTGA 2 S P+ S P + TTP P P+T+P +G+ Sbjct: 1367 SDEPTPSETPEEPTPTTTPTPTPSTTPTSGS 1397
>ZN297_MOUSE (Q9Z0G7) Zinc finger protein 297 (BING1 protein)| Length = 638 Score = 27.7 bits (60), Expect = 9.0 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -2 Query: 103 EPASRTPSSSAEPRARSIATTPIPLPTTS 17 EP++ +PS + P S+A P+PLP + Sbjct: 2 EPSALSPSGATLPLPLSLAPPPLPLPAAA 30
>FIG2_YEAST (P25653) Factor-induced gene 2 precursor (Cell wall adhesin FIG2)| Length = 1609 Score = 27.7 bits (60), Expect = 9.0 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = -2 Query: 103 EPASRTPSSSAEPRARSIATTPIPLPTTSPRTGA 2 E AS T SS+A+P S +++ LP T+P + + Sbjct: 126 EKASSTLSSTAQPHRTSHSSSSFELPVTAPSSSS 159 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,879,761 Number of Sequences: 219361 Number of extensions: 182071 Number of successful extensions: 1450 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1151 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1448 length of database: 80,573,946 effective HSP length: 26 effective length of database: 74,870,560 effective search space used: 1796893440 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)