| Clone Name | bags12d14 |
|---|---|
| Clone Library Name | barley_pub |
>TLR9_CANFA (Q5I2M8) Toll-like receptor 9 precursor (CD289 antigen)| Length = 1032 Score = 30.0 bits (66), Expect = 4.9 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +1 Query: 496 LYSLCNDREANLWSLFWCFHACLGW 570 L+ LC W L++CFH CL W Sbjct: 837 LHQLCG------WDLWYCFHLCLAW 855
>TLR9_FELCA (Q5I2M7) Toll-like receptor 9 precursor (CD289 antigen)| Length = 1031 Score = 29.6 bits (65), Expect = 6.4 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +1 Query: 496 LYSLCNDREANLWSLFWCFHACLGW 570 L+ LC W L++CFH CL W Sbjct: 835 LHHLCG------WDLWYCFHLCLAW 853
>POLG_HRV1B (P12916) Genome polyprotein [Contains: Coat protein VP4 (P1A); Coat| protein VP2 (P1B); Coat protein VP3 (P1C); Coat protein VP1 (P1D); Picornain 2A (EC 3.4.22.29) (Core protein P2A); Core protein P2B; Core protein P2C; Core protein P3A; Genome Length = 2156 Score = 29.6 bits (65), Expect = 6.4 Identities = 13/39 (33%), Positives = 23/39 (58%) Frame = +1 Query: 280 NTGQKKVTVDVKATSDISIKQTLVPLSKGESKRVSIIYN 396 N Q+K+ ++ D+S K +PL E+KR+ ++YN Sbjct: 1160 NATQEKIKCEIDTLHDLSCK--FLPLYAHEAKRIKVLYN 1196
>TLR9_PIG (Q5I2M3) Toll-like receptor 9 precursor (CD289 antigen)| Length = 1030 Score = 29.6 bits (65), Expect = 6.4 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +1 Query: 496 LYSLCNDREANLWSLFWCFHACLGW 570 L+ LC W L++CFH CL W Sbjct: 834 LHHLCG------WDLWYCFHLCLAW 852
>TLR9_HUMAN (Q9NR96) Toll-like receptor 9 precursor (CD289 antigen)| Length = 1032 Score = 29.6 bits (65), Expect = 6.4 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +1 Query: 496 LYSLCNDREANLWSLFWCFHACLGW 570 L+ LC W L++CFH CL W Sbjct: 835 LHHLCG------WDLWYCFHLCLAW 853
>RTCA_METJA (Q60335) Probable RNA 3'-terminal phosphate cyclase (EC 6.5.1.4)| (RNA-3'-phosphate cyclase) (RNA cyclase) Length = 338 Score = 29.3 bits (64), Expect = 8.4 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = +1 Query: 268 FIVQNTGQKKVTVDVKATSDISIK-QTLVPLSKGESKRVSIIYNG 399 FI K T+D+ IS+ QTL+PLS G +K+ ++ G Sbjct: 77 FIPSKLSPKDFTIDIGTAGSISLVIQTLLPLSLGINKKFTVKIKG 121 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 74,553,813 Number of Sequences: 219361 Number of extensions: 1373018 Number of successful extensions: 3099 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 3021 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3098 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4872342800 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)