| Clone Name | rbaal9g24 |
|---|---|
| Clone Library Name | barley_pub |
>UBCD4_DROME (P52486) Ubiquitin-conjugating enzyme E2-22 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 199 Score = 37.0 bits (84), Expect = 0.042 Identities = 21/59 (35%), Positives = 31/59 (52%), Gaps = 2/59 (3%) Frame = -1 Query: 450 FVSTARYWTEAFAKSDST--GMEEKVQKLVEMGFPEDMVRSALKSVNGDENMALEKLCS 280 F+ TA++WT A+A T + K+Q+L +MG E R+ L N + A E L S Sbjct: 141 FLLTAKHWTNAYAGGPHTFPDCDSKIQRLRDMGIDEHEARAVLSKENWNLEKATEGLFS 199
>DDI1_YEAST (P40087) DNA damage-inducible protein DDI1 (v-SNARE-master 1)| Length = 428 Score = 35.0 bits (79), Expect = 0.16 Identities = 18/52 (34%), Positives = 27/52 (51%) Frame = -1 Query: 441 TARYWTEAFAKSDSTGMEEKVQKLVEMGFPEDMVRSALKSVNGDENMALEKL 286 T R A + T E+ +++L+++GFP D V ALK NG+ A L Sbjct: 375 TGRSTAGATTATGRTFPEQTIKQLMDLGFPRDAVVKALKQTNGNAEFAASLL 426
>UBC1_YEAST (P21734) Ubiquitin-conjugating enzyme E2-24 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 215 Score = 34.7 bits (78), Expect = 0.21 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = -1 Query: 471 YLRDKATFVSTARYWTEAFAKSDSTGMEEKVQKLVEMGFPEDMV 340 YLRD+ +F TA WT +A S G + V++ G D++ Sbjct: 130 YLRDRESFNKTAALWTRLYASETSNGQKGNVEESDLYGIDHDLI 173
>Y3846_ARATH (Q8LB17) Protein At3g58460| Length = 403 Score = 33.1 bits (74), Expect = 0.60 Identities = 17/37 (45%), Positives = 23/37 (62%) Frame = -1 Query: 390 EEKVQKLVEMGFPEDMVRSALKSVNGDENMALEKLCS 280 EE++QKLV MGF V AL + + D +A+E L S Sbjct: 364 EEQIQKLVAMGFDRTQVEVALAAADDDLTVAVEILMS 400
>EF3_CANGA (O93796) Elongation factor 3 (EF-3)| Length = 1045 Score = 30.8 bits (68), Expect = 3.0 Identities = 16/42 (38%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = -1 Query: 417 FAKSDSTGMEEKVQ-KLVEMGFPEDMVRSALKSVNGDENMAL 295 F S G +E + KLVE GF E+M+ + S++G M L Sbjct: 511 FVVSSEVGTKEAITAKLVEFGFTEEMINMPISSLSGGWKMKL 552
>BMP2K_HUMAN (Q9NSY1) BMP-2-inducible protein kinase (EC 2.7.11.1) (BIKe)| Length = 1161 Score = 30.8 bits (68), Expect = 3.0 Identities = 15/48 (31%), Positives = 23/48 (47%) Frame = +3 Query: 405 HSLQTPRSNSEQY*QMWPCHADTVVQQQHPEDHQGQEQKEELEGIAMP 548 HS+ P+ ++ QY M P + QQQ HQ +Q+ E + P Sbjct: 521 HSVYQPQPSASQYPTMMPQYQQAFFQQQMLAQHQPSQQQASPEYLTSP 568
>UBP14_SCHPO (Q11119) Ubiquitin carboxyl-terminal hydrolase 14 (EC 3.1.2.15)| (Ubiquitin thioesterase 14) (Ubiquitin-specific-processing protease 14) (Deubiquitinating enzyme 14) (UBA-domain-containing protein 2) Length = 775 Score = 30.4 bits (67), Expect = 3.9 Identities = 20/69 (28%), Positives = 32/69 (46%) Frame = -1 Query: 426 TEAFAKSDSTGMEEKVQKLVEMGFPEDMVRSALKSVNGDENMALEKLCSG*RPCMAYKKC 247 +E K+DS+ EE VQ L E GF R L N + A++ + + P ++++ Sbjct: 630 SELLPKADSSVSEENVQSLCEFGFTVAQARKGLLESNNNIERAVDWILN--HPDESFEEP 687 Query: 246 KLRGHSYGI 220 L G I Sbjct: 688 PLEGSDSSI 696
>LAMA_DROME (Q00174) Laminin alpha chain precursor| Length = 3712 Score = 30.4 bits (67), Expect = 3.9 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -1 Query: 108 YHN*ADCLPCLCHSHGS 58 Y++ DCLPC C SHGS Sbjct: 623 YYSYPDCLPCHCDSHGS 639
>5HT2A_DROME (P28285) 5-hydroxytryptamine receptor 2A (5-HT receptor) (Serotonin| receptor 2A) Length = 834 Score = 30.4 bits (67), Expect = 3.9 Identities = 17/55 (30%), Positives = 25/55 (45%) Frame = +3 Query: 393 CQWSHSLQTPRSNSEQY*QMWPCHADTVVQQQHPEDHQGQEQKEELEGIAMPSSR 557 C SH L + S + T QQ H + HQ Q+Q+++L IA P + Sbjct: 679 CNQSHPLCGTANESPSTPEPRSRQPTTPQQQPHQQAHQQQQQQQQLSSIANPMQK 733
>RRPL_SEOU8 (P27314) RNA-directed RNA polymerase (EC 2.7.7.48) (L protein)| Length = 2151 Score = 30.0 bits (66), Expect = 5.1 Identities = 21/58 (36%), Positives = 29/58 (50%), Gaps = 6/58 (10%) Frame = -1 Query: 393 MEEKVQKLVEMGFPEDMVRSALKSVNGDENMALEKLCSG*R------PCMAYKKCKLR 238 MEE ++LV G +R + VNG +++ L K SG PC+ YK C LR Sbjct: 1767 MEEVSKELVRCG-----MRFNTEQVNGVKHLVLFKTDSGFEWGKPNIPCIVYKNCALR 1819
>URED_RHIME (P42888) Urease accessory protein ureD| Length = 277 Score = 29.6 bits (65), Expect = 6.7 Identities = 22/79 (27%), Positives = 34/79 (43%) Frame = +1 Query: 235 ATQFTLLIGHTRPSARAELLESHVLVAVHALQGASHHILGEAXXXXXXXXXXXASGVTLC 414 A F L+ + P ++L + + +A HAL G SH+ +G A G L Sbjct: 199 AAAFATLV-YAAPDCESQLSKLRLALAGHALSGVSHYDVG--GRDKIVARVAAADGFALR 255 Query: 415 KRLGPIASSTNKCGLVTQI 471 K L P+ S K V ++ Sbjct: 256 KILIPLISHLRKDASVPKV 274 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 74,328,691 Number of Sequences: 219361 Number of extensions: 1343473 Number of successful extensions: 4086 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 3773 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4056 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 5044307840 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)