| Clone Name | bags11m14 |
|---|---|
| Clone Library Name | barley_pub |
>K0971_MOUSE (Q922E6) Protein KIAA0971 homolog| Length = 689 Score = 33.1 bits (74), Expect = 0.66 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 2/63 (3%) Frame = -2 Query: 591 GRTLKCKHKVY--RPCLEISRQSYKQAYIKK*VLNMLERQPDMPILEPLAKLLQGSTGSE 418 G T K HK++ CL++ +YK +I L + QP+ + E L++LL+G E Sbjct: 517 GDTEKNIHKLHVLNTCLKLDESTYKSVHIPLPQLPLSASQPNEKLAEVLSRLLEG----E 572 Query: 417 GKF 409 G+F Sbjct: 573 GRF 575
>ASPM_ATEGE (P62284) Abnormal spindle-like microcephaly-associated protein| homolog (Fragment) Length = 1564 Score = 30.4 bits (67), Expect = 4.2 Identities = 15/46 (32%), Positives = 24/46 (52%) Frame = +1 Query: 226 WHLQSRNMAYKVF*GANTWYMIDKSFCFSVFIIVACVIFIRELFRC 363 WHL+ R K +WY + K V+ + +CV+ I++ FRC Sbjct: 94 WHLRKRAKEEKSAIVIQSWYRMHKQLRKYVY-VRSCVVIIQKRFRC 138
>ASPM_AOTVO (P62283) Abnormal spindle-like microcephaly-associated protein| homolog Length = 3473 Score = 30.4 bits (67), Expect = 4.2 Identities = 15/46 (32%), Positives = 24/46 (52%) Frame = +1 Query: 226 WHLQSRNMAYKVF*GANTWYMIDKSFCFSVFIIVACVIFIRELFRC 363 WHL+ R K +WY + K V+ + +CV+ I++ FRC Sbjct: 1452 WHLRKRAKEEKSAIVIQSWYRMHKQLQKYVY-VRSCVVIIQKRFRC 1496
>Y1375_METJA (Q58770) Hypothetical protein MJ1375| Length = 415 Score = 30.4 bits (67), Expect = 4.2 Identities = 17/66 (25%), Positives = 36/66 (54%), Gaps = 1/66 (1%) Frame = +2 Query: 320 SLLHVSFLSENYLGVIK*SELVSRSLFQVSNFPSLPVLPCSNLAKGSKIGMSGCLSN-MF 496 +++ +S + + G+ S L+SR +F ++ S+P+LP + K + G + N +F Sbjct: 242 NIVIMSIMGGFWSGIYGYSSLISRGIFMFASAVSIPLLPRISKTKDLSLLKEGIIQNTIF 301 Query: 497 KTYFLI 514 + F+I Sbjct: 302 SSIFVI 307
>ASPM_SAIBB (P62296) Abnormal spindle-like microcephaly-associated protein| homolog Length = 3469 Score = 30.4 bits (67), Expect = 4.2 Identities = 15/46 (32%), Positives = 24/46 (52%) Frame = +1 Query: 226 WHLQSRNMAYKVF*GANTWYMIDKSFCFSVFIIVACVIFIRELFRC 363 WHL+ R K +WY + K V+ + +CV+ I++ FRC Sbjct: 1447 WHLRKRAKEEKSAIVIQSWYRMHKQLRKYVY-VRSCVVIIQKRFRC 1491
>ASPM_SAGLB (P62295) Abnormal spindle-like microcephaly-associated protein| homolog (Fragment) Length = 1527 Score = 30.0 bits (66), Expect = 5.6 Identities = 15/46 (32%), Positives = 23/46 (50%) Frame = +1 Query: 226 WHLQSRNMAYKVF*GANTWYMIDKSFCFSVFIIVACVIFIRELFRC 363 WHL+ R K +WY + K ++ ACV+ I++ FRC Sbjct: 49 WHLRKRAKEEKSAIVIQSWYRMHKQLQKYAYVR-ACVVIIQKRFRC 93
>ALG10_YEAST (P50076) Alpha-1,2 glucosyltransferase ALG10 (EC 2.4.1.-)| (Alpha-2-glucosyltransferase ALG10) (Dolichyl-phosphoglucose-dependent glucosyltransferase ALG10) (Asparagine-linked glycosylation protein 10) Length = 525 Score = 29.6 bits (65), Expect = 7.2 Identities = 13/42 (30%), Positives = 25/42 (59%) Frame = +3 Query: 384 YLVPYFRYQIFLHYRCYPVVIWLKVPKLACQAASLTCSKLIF 509 Y++PYF ++IF+ C P++ LK K +++ +K +F Sbjct: 449 YILPYFFWRIFITCSCEPLIKDLKPAKEGENPITISSTKRLF 490 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 82,882,870 Number of Sequences: 219361 Number of extensions: 1623977 Number of successful extensions: 2933 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2875 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2929 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5481822624 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)