| Clone Name | bags12a14 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PI5K1_ORYSA (Q6EX42) Phosphatidylinositol-4-phosphate 5-kinase 1... | 29 | 9.2 | 2 | ZN619_HUMAN (Q8N2I2) Zinc finger protein 619 | 29 | 9.2 | 3 | PYC_PICAN (Q8X1T3) Pyruvate carboxylase (EC 6.4.1.1) (Pyruvic ca... | 29 | 9.2 |
|---|
>PI5K1_ORYSA (Q6EX42) Phosphatidylinositol-4-phosphate 5-kinase 1 precursor (EC| 2.7.1.68) (1-phosphatidylinositol-4-phosphate kinase) (PIP5K) (PtdIns(4)P-5-kinase) (Diphosphoinositide kinase) Length = 801 Score = 28.9 bits (63), Expect = 9.2 Identities = 17/43 (39%), Positives = 24/43 (55%), Gaps = 5/43 (11%) Frame = +1 Query: 187 VVQKLLLN-----FVRRPQIPSNDSHPVFSDDGGPGVLQRVGS 300 ++QKL N F+ RP+ SN + PVF D+ G + Q V S Sbjct: 257 LLQKLCKNWRLRRFLHRPRRISNGTTPVFDDNSGSHLCQDVSS 299
>ZN619_HUMAN (Q8N2I2) Zinc finger protein 619| Length = 560 Score = 28.9 bits (63), Expect = 9.2 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +3 Query: 402 CSAYSDPLPKMHLNERVHSNRRCLHE*FNYQCQGC 506 C +Y +P HL++RVH+N + Y C+ C Sbjct: 193 CGSYYNPHSDFHLHQRVHTNEK------PYTCKEC 221
>PYC_PICAN (Q8X1T3) Pyruvate carboxylase (EC 6.4.1.1) (Pyruvic carboxylase)| (PCB) Length = 1175 Score = 28.9 bits (63), Expect = 9.2 Identities = 25/105 (23%), Positives = 43/105 (40%), Gaps = 8/105 (7%) Frame = +1 Query: 232 PSNDSHPVFSDDGGPGVLQRVGSAAANFVLLPYYTFNYFVSASAEGATSQLADNSLLVLL 411 P V+ GG GV G+ A ++ P+Y + V S G+ ++A ++ L Sbjct: 377 PDTGKIEVYRSSGGNGVRLDGGNGFAGAIISPHYD-SMLVKCSTSGSNYEIARRKMIRAL 435 Query: 412 ILIHYRKCISMNESIP------TDGVYMSDS--TTNVKDAPAFHE 522 + R + +IP T ++S TT + D P+ E Sbjct: 436 VEFRIR---GVKTNIPFLLALLTHPTFVSGDCWTTFIDDTPSLFE 477 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 68,456,723 Number of Sequences: 219361 Number of extensions: 1241446 Number of successful extensions: 2845 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2771 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2845 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4085413911 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)