| Clone Name | bags11j09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YP133_YEAST (P19541) Putative transcriptional regulatory protein... | 30 | 4.4 | 2 | MAPT_ARATH (Q9T041) Microtubule-associated protein TORTIFOLIA1 (... | 29 | 7.5 | 3 | ALF1_SYNY3 (P74309) Fructose-bisphosphate aldolase class 1 (EC 4... | 28 | 9.7 |
|---|
>YP133_YEAST (P19541) Putative transcriptional regulatory protein YPL133C| Length = 446 Score = 29.6 bits (65), Expect = 4.4 Identities = 14/46 (30%), Positives = 28/46 (60%), Gaps = 1/46 (2%) Frame = +2 Query: 197 NAGNQITSVYKYTNMLGNPLLAEKELALASRSGL-FSSSMQKSHTP 331 N G++ +S+ ++ +ML NPLL + L+ +S S + + Q + +P Sbjct: 128 NVGSEFSSLNEFLSMLENPLLTQTSLSSSSASNVHLENGSQTTQSP 173
>MAPT_ARATH (Q9T041) Microtubule-associated protein TORTIFOLIA1| (Microtubule-associated protein SPIRAL2) (Protein CONVOLUTA) Length = 864 Score = 28.9 bits (63), Expect = 7.5 Identities = 10/42 (23%), Positives = 22/42 (52%) Frame = -1 Query: 130 MHRILLHWKDELLNILFDDKASPIGLPTDDAAKAAHRMRSSC 5 ++ I L W +LL ++ D A G+P + + + ++ +C Sbjct: 789 LYDICLSWSQQLLELVLQDGADTFGVPMELKTEILYNLQDAC 830
>ALF1_SYNY3 (P74309) Fructose-bisphosphate aldolase class 1 (EC 4.1.2.13)| (Fructose-biphosphate aldolase class I) (FBP aldolase) Length = 300 Score = 28.5 bits (62), Expect = 9.7 Identities = 10/32 (31%), Positives = 20/32 (62%) Frame = +3 Query: 282 QVDLVCSHQACKSLIHRRVLLSHMKKLLEGNW 377 +VD+ CS +A + ++ +L H+ +L +G W Sbjct: 183 EVDIHCSEKAQAEALLKQAMLKHLNQLPKGQW 214 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 67,405,576 Number of Sequences: 219361 Number of extensions: 1260415 Number of successful extensions: 2782 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2752 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2782 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3304846491 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)