| Clone Name | rbaal9f07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GPI11_GIBZE (Q4HXT5) Glycosylphosphatidylinositol anchor biosynt... | 30 | 6.0 | 2 | ZN292_HUMAN (O60281) Zinc finger protein 292 | 30 | 6.0 | 3 | TW10_NAJSP (Q802B2) Weak neurotoxin 10 precursor (Wntx-10) | 30 | 7.9 |
|---|
>GPI11_GIBZE (Q4HXT5) Glycosylphosphatidylinositol anchor biosynthesis protein| 11 Length = 255 Score = 30.0 bits (66), Expect = 6.0 Identities = 17/61 (27%), Positives = 29/61 (47%) Frame = +2 Query: 236 SSKCSLCADRAHA*ALVGRFAWKADCLF*PPTIFKEREVDTVSCLGSPMLSFDMPTSSST 415 +S +L A AH+ L G F W+ D L P + + V+ + + L +P + S+ Sbjct: 28 NSPLALPASIAHSVLLAGLFYWRFDALVADPVTSLQTGLPVVAAIQAVYLMLSLPPAGSS 87 Query: 416 L 418 L Sbjct: 88 L 88
>ZN292_HUMAN (O60281) Zinc finger protein 292| Length = 1969 Score = 30.0 bits (66), Expect = 6.0 Identities = 16/46 (34%), Positives = 21/46 (45%) Frame = -3 Query: 420 INVDELVGMSKLSIGDPKQDTVSTSLSLKMVGGQNRQSAFQANLPT 283 + D LV L IGD + ++ M Q+AFQ NLPT Sbjct: 246 VTQDSLVNSETLKIGDLTPQNLERQVNNLMTFSVQNQAAFQNNLPT 291
>TW10_NAJSP (Q802B2) Weak neurotoxin 10 precursor (Wntx-10)| Length = 86 Score = 29.6 bits (65), Expect = 7.9 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = +2 Query: 446 GFTISCVPCPRSSPSF*FCQKGTENCKNGEK 538 G+T++C+ CP FC+K + C+NGEK Sbjct: 19 GYTLTCLNCPEV-----FCKK-FQTCRNGEK 43 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 89,605,412 Number of Sequences: 219361 Number of extensions: 1943774 Number of successful extensions: 5402 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5240 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5402 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5938641176 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)