| Clone Name | bags10l08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Y1998_PARUW (Q6M9M7) Hypothetical RNA methyltransferase pc1998 (... | 32 | 1.4 | 2 | TIP_PLAF7 (Q8I3H7) T-cell immunomodulatory protein homolog precu... | 30 | 5.3 | 3 | YGN2_YEAST (P53126) Hypothetical 12.2 kDa protein in RPL1B-CEG1 ... | 29 | 9.1 | 4 | KEFG_SHIFL (Q83PX9) Glutathione-regulated potassium-efflux syste... | 29 | 9.1 |
|---|
>Y1998_PARUW (Q6M9M7) Hypothetical RNA methyltransferase pc1998 (EC 2.1.1.-)| Length = 383 Score = 31.6 bits (70), Expect = 1.4 Identities = 10/28 (35%), Positives = 19/28 (67%) Frame = +2 Query: 2 EAWHLENAHAFNFFPGTDSIEVLAIFRR 85 + W+L+ ++ FPG++ IE+L +F R Sbjct: 356 QGWNLKKLEGYSLFPGSEHIELLTLFER 383
>TIP_PLAF7 (Q8I3H7) T-cell immunomodulatory protein homolog precursor| Length = 719 Score = 29.6 bits (65), Expect = 5.3 Identities = 16/56 (28%), Positives = 26/56 (46%) Frame = +2 Query: 287 DEFYIGQTKHQPKDLNLGQGICRNSRS*FVSIRNLHSVLFPYRVNQH*DCAVQVSL 454 +EFY+G H+ K N+ I NS H ++ PY +N +Q+S+ Sbjct: 625 EEFYVGMPTHEQKYYNMWVSIIPNS----------HIIVIPYPLNNSNKWQIQLSV 670
>YGN2_YEAST (P53126) Hypothetical 12.2 kDa protein in RPL1B-CEG1 intergenic| region Length = 111 Score = 28.9 bits (63), Expect = 9.1 Identities = 20/70 (28%), Positives = 35/70 (50%), Gaps = 1/70 (1%) Frame = +3 Query: 243 DACIFTADPENWVAAMNFTSAKRSINRRISI*GK-VFVETHVASLSQSGTYIPCYSLIV* 419 D C+F + P + ++ N + SIN + GK + +E +LS+S ++ P L Sbjct: 27 DGCVFLSVPASEISISNIAGSIPSINCWVISTGKPLSLEILADALSKSSSWAPDLKLQEW 86 Query: 420 TSIETVQYRL 449 I + QY+L Sbjct: 87 QIISSYQYKL 96
>KEFG_SHIFL (Q83PX9) Glutathione-regulated potassium-efflux system ancillary| protein kefG Length = 183 Score = 28.9 bits (63), Expect = 9.1 Identities = 19/62 (30%), Positives = 30/62 (48%), Gaps = 6/62 (9%) Frame = -3 Query: 359 SFYKYLALN*DPSVDA------SFGRCKIHRSNPIFWVGGKDASIRQISTTARATSSLLV 198 S Y+Y ALN P D + G C++H +PI + S +++++ ARA L Sbjct: 116 SAYRYDALNRYPMSDVLRPFELAAGMCRMHWLSPIIIYWARRQSAKELASHARAYGDWLA 175 Query: 197 *P 192 P Sbjct: 176 NP 177 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 68,333,585 Number of Sequences: 219361 Number of extensions: 1176099 Number of successful extensions: 2607 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2572 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2607 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4027872870 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)