| Clone Name | bags10d12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | DSPP_HUMAN (Q9NZW4) Dentin sialophosphoprotein precursor [Contai... | 32 | 1.0 | 2 | PUR72_BRAJA (Q89W81) Putative phosphoribosylaminoimidazole-succi... | 32 | 1.8 | 3 | ENV_HV1Z2 (P12487) Envelope polyprotein GP160 precursor [Contain... | 29 | 8.7 | 4 | AAC_ACTUT (P29958) Aculeacin A acylase precursor (EC 3.5.1.-) [C... | 29 | 8.7 |
|---|
>DSPP_HUMAN (Q9NZW4) Dentin sialophosphoprotein precursor [Contains: Dentin| phosphoprotein (Dentin phosphophoryn) (DPP); Dentin sialoprotein (DSP)] Length = 1253 Score = 32.3 bits (72), Expect = 1.0 Identities = 24/85 (28%), Positives = 37/85 (43%), Gaps = 2/85 (2%) Frame = +2 Query: 197 ANDDDEEGVTLRKKKGISPADSAELGQGKKTPSPELGEVVTSDMSGRRTISRSSDSGRMG 376 AN + + + R + +S + G G + E + SD + S S+ +G G Sbjct: 477 ANSESDNNSSSRGDASYNSDESKDNGNGSDSKGAEDDD---SDSTSDTNNSDSNGNGNNG 533 Query: 377 ND--DKEDLELGKGDYMDVDRGEAS 445 ND DK D GK D D D ++S Sbjct: 534 NDDNDKSDSGKGKSDSSDSDSSDSS 558
>PUR72_BRAJA (Q89W81) Putative phosphoribosylaminoimidazole-succinocarboxamide| synthase B (EC 6.3.2.6) (SAICAR synthetase 2) Length = 304 Score = 31.6 bits (70), Expect = 1.8 Identities = 26/85 (30%), Positives = 38/85 (44%), Gaps = 1/85 (1%) Frame = +2 Query: 218 GVTLRKKKGISPADSA-ELGQGKKTPSPELGEVVTSDMSGRRTISRSSDSGRMGNDDKED 394 G L +++GI AD+ E G+ K + EV+T D S + + DK+ Sbjct: 196 GEELAREQGIIIADTKFEFGRDKDGRIILIDEVMTPDSSRFWAVDAYKPGQPQASFDKQP 255 Query: 395 LELGKGDYMDVDRGEASVNGSANRP 469 L DY+DV+R NG A P Sbjct: 256 LR----DYLDVERRAGRWNGDAPPP 276
>ENV_HV1Z2 (P12487) Envelope polyprotein GP160 precursor [Contains: Exterior| membrane glycoprotein (GP120); Transmembrane glycoprotein (GP41)] Length = 853 Score = 29.3 bits (64), Expect = 8.7 Identities = 25/91 (27%), Positives = 40/91 (43%), Gaps = 1/91 (1%) Frame = +2 Query: 170 NISTSRWAGANDDDEEGVTLRKKKGISPADSAELGQGKKTPSPEL-GEVVTSDMSGRRTI 346 +IS S WA + + D++ +TL+ + I + G GK +P + G++ S + Sbjct: 394 DISKSEWANSTESDDKPITLQCR--IKQIINMWQGVGKAMYAPPIEGQINCSSNITGLLL 451 Query: 347 SRSSDSGRMGNDDKEDLELGKGDYMDVDRGE 439 +R G N E G GD D R E Sbjct: 452 TR---DGGTNNSSNETFRPGGGDMRDNWRSE 479
>AAC_ACTUT (P29958) Aculeacin A acylase precursor (EC 3.5.1.-) [Contains:| Aculeacin A small subunit; Aculeacin A large subunit] Length = 786 Score = 29.3 bits (64), Expect = 8.7 Identities = 18/36 (50%), Positives = 24/36 (66%), Gaps = 1/36 (2%) Frame = -3 Query: 534 RWAGFTGSGVSDLR-TSSSESEDGRLAEPLTLASPR 430 RW G TG +D+R TSS+++ D R+AE L L PR Sbjct: 88 RWFGATGPDDADVRTTSSTQAIDDRVAERL-LEGPR 122 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 74,991,396 Number of Sequences: 219361 Number of extensions: 1385404 Number of successful extensions: 3843 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3733 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3835 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 5044307840 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)