| Clone Name | rbasd3o11 |
|---|---|
| Clone Library Name | barley_pub |
>LAT_RAT (O70601) Linker for activation of T-cells family member 1 (36 kDa| phospho-tyrosine adapter protein) (pp36) (p36-38) Length = 241 Score = 31.6 bits (70), Expect = 2.0 Identities = 20/49 (40%), Positives = 22/49 (44%) Frame = -2 Query: 518 LLALVVRAMNKPAEYDSDDEIIGTARSTSIRQPLIHSQNAPATGVPVPT 372 L AL VR PA YDS RS I+ P I PAT P+ T Sbjct: 23 LAALCVRCRELPASYDSASTESLYPRSILIKPPQITVPRTPATSYPLVT 71
>IKKA_MOUSE (Q60680) Inhibitor of nuclear factor kappa-B kinase alpha subunit| (EC 2.7.11.10) (I kappa-B kinase alpha) (IkBKA) (IKK-alpha) (IKK-A) (IkappaB kinase) (I-kappa-B kinase 1) (IKK1) (Conserved helix-loop-helix ubiquitous kinase) (Nuclear factor N Length = 745 Score = 30.8 bits (68), Expect = 3.5 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = -3 Query: 103 SLP*CSSYLLSFEQFHAPVIFLERVWQSISHYIS 2 SL C +Y++ + P+I L +VW HY+S Sbjct: 402 SLSDCVNYIVQDSKIQLPIIQLRKVWAEAVHYVS 435
>IKKA_HUMAN (O15111) Inhibitor of nuclear factor kappa-B kinase alpha subunit| (EC 2.7.11.10) (I kappa-B kinase alpha) (IkBKA) (IKK-alpha) (IKK-A) (IkappaB kinase) (I-kappa-B kinase 1) (IKK1) (Conserved helix-loop-helix ubiquitous kinase) (Nuclear factor N Length = 745 Score = 30.8 bits (68), Expect = 3.5 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = -3 Query: 103 SLP*CSSYLLSFEQFHAPVIFLERVWQSISHYIS 2 SL C +Y++ + P+I L +VW HY+S Sbjct: 402 SLSDCVNYIVQDSKIQLPIIQLRKVWAEAVHYVS 435
>NU4C_PSINU (Q8WHX8) NAD(P)H-quinone oxidoreductase chain 4, chloroplast (EC| 1.6.5.-) (NAD(P)H dehydrogenase, chain 4) (NADH-plastoquinone oxidoreductase chain 4) Length = 498 Score = 30.0 bits (66), Expect = 5.9 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -1 Query: 582 KTGKIARWVALGVVIFQVLLFLVSSCCQ 499 K K+ RW LG+ + LL + CCQ Sbjct: 27 KGNKVVRWYTLGICALEFLLITFTFCCQ 54
>CO7A1_HUMAN (Q02388) Collagen alpha-1(VII) chain precursor (Long-chain| collagen) (LC collagen) Length = 2944 Score = 29.6 bits (65), Expect = 7.7 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = -2 Query: 326 REKYGLDTSQFTYNPSDATRYQQNGAPPAEE 234 R + GL+ Q PSD TRYQ +G P E Sbjct: 449 RRETGLEPPQKVVLPSDVTRYQLDGLQPGTE 479
>GLGA1_NITOC (Q3JEW3) Glycogen synthase 1 (EC 2.4.1.21) (Starch [bacterial| glycogen] synthase 1) Length = 487 Score = 29.6 bits (65), Expect = 7.7 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = -1 Query: 72 LLNNSMHL*FSWNEYGNQYLIIFH 1 L+ N M FSWN G YL I+H Sbjct: 459 LMENGMRYDFSWNHPGQHYLNIYH 482 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 95,515,122 Number of Sequences: 219361 Number of extensions: 2042945 Number of successful extensions: 5070 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 4912 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5069 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5824436538 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)