| Clone Name | rbasd3l15 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | LEC_LATSP (P16349) Lectin | 32 | 1.6 | 2 | FP1_MYTCO (Q25434) Adhesive plaque matrix protein precursor (Foo... | 32 | 2.1 | 3 | DGK3_CAEEL (Q03603) Probable diacylglycerol kinase 3 (EC 2.7.1.1... | 31 | 3.5 | 4 | TRPB_PROMP (Q7TUH0) Tryptophan synthase beta chain (EC 4.2.1.20) | 30 | 6.0 | 5 | 5HT6R_RAT (P31388) 5-hydroxytryptamine 6 receptor (5-HT-6) (Sero... | 30 | 7.9 |
|---|
>LEC_LATSP (P16349) Lectin| Length = 244 Score = 32.0 bits (71), Expect = 1.6 Identities = 16/48 (33%), Positives = 26/48 (54%) Frame = +1 Query: 13 FDTLHHTPRVPPYMNMTHGSYVNNLAHLLQTYINPHVTTYNCRRITHK 156 FDT H+ P P Y+++ G +N++ + NPH TY+ I +K Sbjct: 131 FDTFHNQPWDPDYIHI--GVDINSIKSRITRPWNPHYDTYSIAYIAYK 176
>FP1_MYTCO (Q25434) Adhesive plaque matrix protein precursor (Foot protein 1)| (MCFP1) Length = 872 Score = 31.6 bits (70), Expect = 2.1 Identities = 23/64 (35%), Positives = 30/64 (46%), Gaps = 11/64 (17%) Frame = +3 Query: 18 YPTPYSQGPT---IYE----YDTRFIRKQF--GTFTPNIHQPPCYNLQ--LPPHYTQDVT 164 YPTPY Q P+ IY+ Y T + K+ T+ P I PP Y + PP Y +T Sbjct: 598 YPTPYKQKPSYPPIYKSKSSYPTAYKSKKTYPPTYKPKITYPPTYKPKPSYPPSYRPKIT 657 Query: 165 KTDT 176 T Sbjct: 658 YPPT 661 Score = 30.4 bits (67), Expect = 4.6 Identities = 23/64 (35%), Positives = 29/64 (45%), Gaps = 11/64 (17%) Frame = +3 Query: 18 YPTPYSQGPT---IYE----YDTRFIRKQF--GTFTPNIHQPPCYNLQ--LPPHYTQDVT 164 YPTPY Q P+ IY+ Y T + K+ T+ P I PP Y + PP Y T Sbjct: 498 YPTPYKQKPSYPPIYKSKSSYPTSYKSKKTYPPTYKPKITYPPTYKPKPSYPPSYKPKTT 557 Query: 165 KTDT 176 T Sbjct: 558 YPPT 561 Score = 30.4 bits (67), Expect = 4.6 Identities = 23/64 (35%), Positives = 30/64 (46%), Gaps = 11/64 (17%) Frame = +3 Query: 18 YPTPYSQGPT---IYE----YDTRFIRKQF--GTFTPNIHQPPCYNLQ--LPPHYTQDVT 164 YPTPY Q P+ IY+ Y T + K+ T+ P I PP Y + PP Y T Sbjct: 318 YPTPYKQKPSYPPIYKSKSSYPTSYKSKKTYPPTYKPKITYPPTYKPKPSYPPSYKPKKT 377 Query: 165 KTDT 176 + T Sbjct: 378 YSPT 381
>DGK3_CAEEL (Q03603) Probable diacylglycerol kinase 3 (EC 2.7.1.107)| (Diglyceride kinase 3) (DGK-3) (DAG kinase 3) Length = 812 Score = 30.8 bits (68), Expect = 3.5 Identities = 15/39 (38%), Positives = 19/39 (48%) Frame = +1 Query: 235 GLLGFRFCRWCNKGPPKVPPACHVHHRPESCLRGRCDLG 351 G+ + CRWC+ +VHHR S L CDLG Sbjct: 349 GVFQGKGCRWCHN---------YVHHRCMSALAQECDLG 378
>TRPB_PROMP (Q7TUH0) Tryptophan synthase beta chain (EC 4.2.1.20)| Length = 414 Score = 30.0 bits (66), Expect = 6.0 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = +1 Query: 73 YVNNLAHLLQTYINPHVTTYNCRRITHKM*PKQIQCKSSPFW 198 +VN L HLL+TY+ Y +R+T Q + +S W Sbjct: 57 FVNELNHLLKTYVGRETPLYEAKRLTEHY---QTKTSTSRIW 95
>5HT6R_RAT (P31388) 5-hydroxytryptamine 6 receptor (5-HT-6) (Serotonin| receptor 6) (ST-B17) Length = 436 Score = 29.6 bits (65), Expect = 7.9 Identities = 13/37 (35%), Positives = 18/37 (48%) Frame = +3 Query: 33 SQGPTIYEYDTRFIRKQFGTFTPNIHQPPCYNLQLPP 143 + P IY R ++ G F P +H PP + LPP Sbjct: 314 TMNPIIYPLFMRDFKRALGRFLPCVHCPPEHRPALPP 350 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 90,243,104 Number of Sequences: 219361 Number of extensions: 1909529 Number of successful extensions: 4971 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 4792 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4967 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 5972710590 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)