| Clone Name | rbaal9e06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | LEP_BUCAP (Q8K9R0) Signal peptidase I (EC 3.4.21.89) (SPase I) (... | 30 | 5.9 | 2 | YMP0_YEAST (Q03687) Hypothetical 46.9 kDa protein in PLB1-HXT2 i... | 30 | 7.7 |
|---|
>LEP_BUCAP (Q8K9R0) Signal peptidase I (EC 3.4.21.89) (SPase I) (Leader| peptidase I) Length = 312 Score = 30.0 bits (66), Expect = 5.9 Identities = 21/57 (36%), Positives = 28/57 (49%), Gaps = 2/57 (3%) Frame = -2 Query: 629 KLYVFSVAKK*SKSPISWYSRILVPYKCFFMSCFSLQT*FFVVY--SHFNFETFQTP 465 K Y ++ K + + I IL KCFF S SL FF+V+ F +E FQ P Sbjct: 29 KNYFYNKKKTKNNNTILINKVILENKKCFFRSLSSLFPTFFIVFIIRSFIYEPFQIP 85
>YMP0_YEAST (Q03687) Hypothetical 46.9 kDa protein in PLB1-HXT2 intergenic| region Length = 405 Score = 29.6 bits (65), Expect = 7.7 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = -3 Query: 199 FLSFMYYMLLMHDPLNARLFVFWKLEDDE 113 FL+F Y +L DP R+ FW+ +DD+ Sbjct: 191 FLAFFYKILKFFDPNFKRIGAFWQWDDDK 219 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 78,306,034 Number of Sequences: 219361 Number of extensions: 1424300 Number of successful extensions: 2565 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2524 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2565 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5824436538 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)