| Clone Name | rbasd3k18 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YCF4_CHLRE (O20030) Photosystem I assembly protein ycf4 | 31 | 3.4 | 2 | JSN1_YEAST (P47135) Protein JSN1 (Protein PUF1) | 31 | 4.5 | 3 | K1688_MOUSE (P59281) Protein KIAA1688 | 30 | 5.8 | 4 | LAMA4_MOUSE (P97927) Laminin alpha-4 chain precursor | 30 | 5.8 | 5 | LYPA3_MOUSE (Q8VEB4) 1-O-acylceramide synthase precursor (EC 2.3... | 30 | 10.0 | 6 | LYPA3_HUMAN (Q8NCC3) 1-O-acylceramide synthase precursor (EC 2.3... | 30 | 10.0 |
|---|
>YCF4_CHLRE (O20030) Photosystem I assembly protein ycf4| Length = 197 Score = 31.2 bits (69), Expect = 3.4 Identities = 14/25 (56%), Positives = 18/25 (72%) Frame = +1 Query: 142 ILFWRRGGFCFNEFTKKEASVRIYK 216 ++FW GG FNEF KKE VRI++ Sbjct: 97 LIFWNVGGG-FNEFNKKEGFVRIFR 120
>JSN1_YEAST (P47135) Protein JSN1 (Protein PUF1)| Length = 1091 Score = 30.8 bits (68), Expect = 4.5 Identities = 17/50 (34%), Positives = 26/50 (52%) Frame = +2 Query: 494 PATSSSFTISKFLYVYPTKFASLDGSIWKNKILSADMKLNMSELNVPTAL 643 P TS++ T S L Y TK A D + + AD K+N + L +P ++ Sbjct: 216 PTTSNNTTNSNTLNDYSTKTAYFDNMVSTSGSQMADNKMNTNNLAIPNSV 265
>K1688_MOUSE (P59281) Protein KIAA1688| Length = 1107 Score = 30.4 bits (67), Expect = 5.8 Identities = 17/48 (35%), Positives = 27/48 (56%), Gaps = 1/48 (2%) Frame = -1 Query: 597 ALRILFFQMLPSKDANFVGYTYKNFEIVNDDEVA-GIAELKKKSSKSK 457 A+ + FF P + GY Y++ + VND +V I EL +++SK K Sbjct: 802 AICLAFFPPTPKFHSYLEGYIYRHMDPVNDTKVTQHIKELLERNSKKK 849
>LAMA4_MOUSE (P97927) Laminin alpha-4 chain precursor| Length = 1816 Score = 30.4 bits (67), Expect = 5.8 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = -3 Query: 142 WCLILAARLVWLAVCWFDSLGDGS 71 WC +LA L+W AVC + GDG+ Sbjct: 7 WCSVLALWLLWCAVCSNAASGDGN 30
>LYPA3_MOUSE (Q8VEB4) 1-O-acylceramide synthase precursor (EC 2.3.1.-) (ACS)| (Lysosomal phospholipase A2) (Lysophospholipase 3) (LCAT-like lysophospholipase) (LLPL) Length = 412 Score = 29.6 bits (65), Expect = 10.0 Identities = 14/44 (31%), Positives = 24/44 (54%) Frame = -2 Query: 497 QGLPS*RKRVPNQNGPTIKTLFESMDEDEPVHGSFLNMLPHKEG 366 +G P +R PN+NGP L E ++E ++G + ++ H G Sbjct: 157 RGAPYDWRRAPNENGPYFLALREMIEEMYQMYGGPVVLVAHSMG 200
>LYPA3_HUMAN (Q8NCC3) 1-O-acylceramide synthase precursor (EC 2.3.1.-) (ACS)| (Lysosomal phospholipase A2) (Lysophospholipase 3) (LPLA2) (LCAT-like lysophospholipase) (LLPL) Length = 412 Score = 29.6 bits (65), Expect = 10.0 Identities = 14/44 (31%), Positives = 24/44 (54%) Frame = -2 Query: 497 QGLPS*RKRVPNQNGPTIKTLFESMDEDEPVHGSFLNMLPHKEG 366 +G P +R PN+NGP L E ++E ++G + ++ H G Sbjct: 157 RGAPYDWRRAPNENGPYFLALREMIEEMYQLYGGPVVLVAHSMG 200 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 106,005,824 Number of Sequences: 219361 Number of extensions: 2166351 Number of successful extensions: 5767 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 5562 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5767 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7536258401 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)