| Clone Name | rbasd3j03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | POLG_HCVH (P27958) Genome polyprotein [Contains: Core protein p2... | 28 | 8.9 |
|---|
>POLG_HCVH (P27958) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (EC 3.4.22.-) (p23); Serine protease/NT Length = 3010 Score = 27.7 bits (60), Expect = 8.9 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = +1 Query: 52 STLGLHHSNGKTRYILFLIRNGKQDRTPSTLNCDTRC 162 S+ G +S G+ + FL++ K +TP L+ DTRC Sbjct: 2608 SSYGFQYSPGQR--VEFLVQAWKSKKTPMGLSYDTRC 2642 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 21,074,883 Number of Sequences: 219361 Number of extensions: 277277 Number of successful extensions: 622 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 619 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 622 length of database: 80,573,946 effective HSP length: 31 effective length of database: 73,773,755 effective search space used: 1770570120 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)