| Clone Name | rbasd3i21 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | NIPM_HUMAN (O43920) NADH-ubiquinone oxidoreductase 15 kDa subuni... | 31 | 2.0 | 2 | TBB1_PORPU (P50259) Tubulin beta-1 chain (Beta-1 tubulin) | 30 | 5.9 |
|---|
>NIPM_HUMAN (O43920) NADH-ubiquinone oxidoreductase 15 kDa subunit (EC 1.6.5.3)| (EC 1.6.99.3) (Complex I-15 kDa) (CI-15 kDa) Length = 105 Score = 31.2 bits (69), Expect = 2.0 Identities = 18/69 (26%), Positives = 31/69 (44%), Gaps = 3/69 (4%) Frame = -3 Query: 483 VDGGEEEEAMASGWGINGNKGRCYDF---WLDFSSCMSRCRQPSDCGLLREDYLECLHHS 313 + GE+ MA GRC+ F W++ + + R +C + +D++ECL Sbjct: 19 IQSGEQPYKMA---------GRCHAFEKEWIECAHGIGYTRAEKECKIEYDDFVECLLRQ 69 Query: 312 KEFQRRNRI 286 K +R I Sbjct: 70 KTMRRAGTI 78
>TBB1_PORPU (P50259) Tubulin beta-1 chain (Beta-1 tubulin)| Length = 457 Score = 29.6 bits (65), Expect = 5.9 Identities = 14/29 (48%), Positives = 21/29 (72%) Frame = -3 Query: 510 ERRKGEAAKVDGGEEEEAMASGWGINGNK 424 E ++ EAA V+G EEE+A A G +NG++ Sbjct: 421 ELQQYEAATVEGEEEEDAYAEGAVVNGDQ 449 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,512,022 Number of Sequences: 219361 Number of extensions: 732715 Number of successful extensions: 2005 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1938 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2005 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4430660157 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)