| Clone Name | rbasd3h10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ZC3H6_HUMAN (P61129) Zinc finger CCCH-type domain-containing pro... | 28 | 5.7 | 2 | PARC_MOUSE (Q80TT8) p53-associated parkin-like cytoplasmic protein | 28 | 5.7 | 3 | IG2R_HUMAN (P09565) Putative insulin-like growth factor 2-associ... | 28 | 7.5 | 4 | SENP2_RAT (Q9EQE1) Sentrin-specific protease 2 (EC 3.4.22.-) (Se... | 27 | 9.8 |
|---|
>ZC3H6_HUMAN (P61129) Zinc finger CCCH-type domain-containing protein 6| Length = 1189 Score = 28.1 bits (61), Expect = 5.7 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +2 Query: 203 DELHRLRRRPPTFGPSASVPSPHSDAS 283 D H++ R+PP F SAS P P S Sbjct: 439 DLAHKIGRKPPAFYTSASPPGPQFQGS 465
>PARC_MOUSE (Q80TT8) p53-associated parkin-like cytoplasmic protein| Length = 1865 Score = 28.1 bits (61), Expect = 5.7 Identities = 12/42 (28%), Positives = 24/42 (57%) Frame = +2 Query: 23 KSKTTCLERCRQSNCTNVRLSFSCLYMYKTE*TEFLDKFQKQ 148 KS T + CR L+++C+Y + ++ TE++D ++Q Sbjct: 1666 KSFTFLQDACRALEQARKVLAYACVYSFYSQDTEYMDVVEQQ 1707
>IG2R_HUMAN (P09565) Putative insulin-like growth factor 2-associated protein| (Insulin-like growth factor II-associated protein) Length = 84 Score = 27.7 bits (60), Expect = 7.5 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +1 Query: 229 APDIWPVGVCAQSP**RFPRCHNCLTHL 312 AP W + Q P + P CHNC TH+ Sbjct: 20 APCEWAIRNIGQKP--KEPNCHNCGTHI 45
>SENP2_RAT (Q9EQE1) Sentrin-specific protease 2 (EC 3.4.22.-)| (Sentrin/SUMO-specific protease SENP2) (Axin-associating molecule) (Axam) Length = 588 Score = 27.3 bits (59), Expect = 9.8 Identities = 14/44 (31%), Positives = 24/44 (54%) Frame = -1 Query: 228 RRRSLWSSSVSTRADSFEVSVFKQALTCF*NLSKNSVHSVLYIY 97 +RR SS ST D+ E+ + L CF + KNS+++ ++ Sbjct: 28 KRRRSSSSLFSTAVDTDEIPAKRPRLDCFIHQVKNSLYNAASLF 71 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,847,953 Number of Sequences: 219361 Number of extensions: 799082 Number of successful extensions: 2273 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2181 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2273 length of database: 80,573,946 effective HSP length: 84 effective length of database: 62,147,622 effective search space used: 1491542928 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)