| Clone Name | rbasd3h02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TFP11_HUMAN (Q9UBB9) Tuftelin-interacting protein 11 | 65 | 1e-10 | 2 | TFP11_MOUSE (Q9ERA6) Tuftelin-interacting protein 11 (Tuftelin-i... | 65 | 1e-10 | 3 | FINC_BOVIN (P07589) Fibronectin (FN) | 31 | 3.1 | 4 | CYB_MANME (Q9TAB1) Cytochrome b | 29 | 8.9 |
|---|
>TFP11_HUMAN (Q9UBB9) Tuftelin-interacting protein 11| Length = 837 Score = 65.1 bits (157), Expect = 1e-10 Identities = 41/117 (35%), Positives = 69/117 (58%), Gaps = 6/117 (5%) Frame = -1 Query: 489 QPGARENVGFLRATEKR---QFDAAQQA--SQYPSYHAVPGAAMS-EMSFKESIQAYAGD 328 QPGAREN+ +L TE+R Q++A Q+ ++ + + AA S M+FK+ I+ A + Sbjct: 724 QPGARENIAYLTHTERRKDFQYEAMQERREAENMAQRGIGVAASSVPMNFKDLIETKAEE 783 Query: 327 QGLLFMPRVNKFYKGMQVYEFGTVSICIDSVKRLLYAQLQEGAERWSSVSLTQLLEM 157 ++FMP + K ++G Q+Y FG + I ID + +++ Q G + W SL L++M Sbjct: 784 HNIVFMPVIGKRHEGKQLYTFGRIVIYID--RGVVFVQ---GEKTWVPTSLQSLIDM 835
>TFP11_MOUSE (Q9ERA6) Tuftelin-interacting protein 11 (Tuftelin-interacting| protein 39) Length = 838 Score = 65.1 bits (157), Expect = 1e-10 Identities = 41/117 (35%), Positives = 69/117 (58%), Gaps = 6/117 (5%) Frame = -1 Query: 489 QPGARENVGFLRATEKR---QFDAAQQA--SQYPSYHAVPGAAMS-EMSFKESIQAYAGD 328 QPGAREN+ +L TE+R Q++A Q+ ++ + + AA S M+FK+ I+ A + Sbjct: 725 QPGARENIAYLTHTERRKDFQYEAMQERREAENMAQRGIGVAASSVPMNFKDLIETKAEE 784 Query: 327 QGLLFMPRVNKFYKGMQVYEFGTVSICIDSVKRLLYAQLQEGAERWSSVSLTQLLEM 157 ++FMP + K ++G Q+Y FG + I ID + +++ Q G + W SL L++M Sbjct: 785 HNIVFMPVIGKRHEGKQLYTFGRIVIYID--RGVVFVQ---GEKTWVPTSLQSLIDM 836
>FINC_BOVIN (P07589) Fibronectin (FN)| Length = 2265 Score = 30.8 bits (68), Expect = 3.1 Identities = 21/69 (30%), Positives = 32/69 (46%) Frame = -1 Query: 483 GARENVGFLRATEKRQFDAAQQASQYPSYHAVPGAAMSEMSFKESIQAYAGDQGLLFMPR 304 G R VG R + +Q++ ASQYP + PG+ + S+ A G+Q PR Sbjct: 995 GYRLTVGLTRGGQPKQYNVGPAASQYPLRNLQPGS-----EYAVSLVAVKGNQQ---SPR 1046 Query: 303 VNKFYKGMQ 277 V + +Q Sbjct: 1047 VTGVFTTLQ 1055
>CYB_MANME (Q9TAB1) Cytochrome b| Length = 380 Score = 29.3 bits (64), Expect = 8.9 Identities = 18/51 (35%), Positives = 28/51 (54%), Gaps = 1/51 (1%) Frame = +3 Query: 402 MGIAMLAVLHQIAASLLLSRSQHSP*-PLAVPTHVLQQLWFIISRPAVRSI 551 M IA+LA L + +LL +P PLA P H+ + +F+ + +RSI Sbjct: 235 MMIALLAALALFSPNLLGDPENFTPANPLATPPHIKPEWYFLFAYAILRSI 285 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 81,708,166 Number of Sequences: 219361 Number of extensions: 1557176 Number of successful extensions: 4855 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4538 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4853 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 5158951200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)