| Clone Name | rbasd3d23 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MASS1_HUMAN (Q8WXG9) Monogenic audiogenic seizure susceptibility... | 30 | 2.7 | 2 | DBP6_KLULA (Q6CKZ4) ATP-dependent RNA helicase DBP6 (EC 3.6.1.-) | 29 | 4.5 | 3 | VIE1_MCMVS (P11210) Immediate-early protein 1 (IE1) (Immediate-e... | 29 | 5.9 |
|---|
>MASS1_HUMAN (Q8WXG9) Monogenic audiogenic seizure susceptibility protein 1| homolog precursor (Very large G-protein coupled receptor 1) (Usher syndrome type-2C protein) (G-protein coupled receptor 98) Length = 6307 Score = 30.0 bits (66), Expect = 2.7 Identities = 19/54 (35%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Frame = -1 Query: 428 NTP*GTLTSLFYFASLIKEGGKEYRNFFSLLPIDKD-KERHTYDMWISRILGYY 270 N+P + + A++I E + FSL PIDK +E T WI R GY+ Sbjct: 1094 NSPGDPVVYQYGVATVIIEANDDPNGIFSLEPIDKAVEEGKTNAFWILRHRGYF 1147
>DBP6_KLULA (Q6CKZ4) ATP-dependent RNA helicase DBP6 (EC 3.6.1.-)| Length = 630 Score = 29.3 bits (64), Expect = 4.5 Identities = 26/84 (30%), Positives = 36/84 (42%), Gaps = 14/84 (16%) Frame = +1 Query: 172 NLCMDSGKIPVLYSITVE*EIKMRMVSS*RKIE*YPKILLIHISYVCLS----------- 318 N SGK + YS+ + ++ R V+ R I P +LIH Y CLS Sbjct: 234 NASTGSGKT-LAYSVPLVQILRSRTVNKVRAIILVPTKILIHQVYDCLSKLSQGTSLNVS 292 Query: 319 ---LSLSIGSSEKKFLYSFPPSLM 381 L S+ KFLY+ P L+ Sbjct: 293 MSKLENSLKEEHNKFLYNSPDILI 316
>VIE1_MCMVS (P11210) Immediate-early protein 1 (IE1) (Immediate-early| phosphoprotein PP89) Length = 595 Score = 28.9 bits (63), Expect = 5.9 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = -3 Query: 165 PFYFRPLFPISXXXLIWMSM*PIESCSYNTYIIVCITIRKRK 40 P Y +P +W M IES S +T+++V ++ R+ Sbjct: 237 PCYTKPFLDAKSQLAVWQQMKAIESESVSTHVVVVEALKLRE 278 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,164,110 Number of Sequences: 219361 Number of extensions: 1204769 Number of successful extensions: 1971 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1949 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1971 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2628831825 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)