| Clone Name | rbasd3c16 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | BDLF2_EBV (P03225) Protein BDLF2 | 35 | 0.14 | 2 | Y1792_ARCFU (O28482) Hypothetical protein AF1792 | 30 | 5.9 | 3 | DPOL_RSIV (O70736) DNA polymerase (EC 2.7.7.7) | 30 | 5.9 | 4 | SM50_STRPU (P11994) 50 kDa spicule matrix protein precursor | 30 | 5.9 |
|---|
>BDLF2_EBV (P03225) Protein BDLF2| Length = 420 Score = 35.4 bits (80), Expect = 0.14 Identities = 21/65 (32%), Positives = 29/65 (44%), Gaps = 4/65 (6%) Frame = -3 Query: 194 LEVYYIYLCCNVCDLLLATAGYNPRFVRKFTSISLYVL----NNLFWCLSGTRKHNPFCA 27 L +IY CC + L L G+NP F+ F + VL + LS NPFC Sbjct: 187 LSFVFIYYCCYLAFLALLAFGFNPLFLPSFMPVGAKVLRGKGRDFGVPLSYGCPTNPFCK 246 Query: 26 IIXLV 12 + L+ Sbjct: 247 VYTLI 251
>Y1792_ARCFU (O28482) Hypothetical protein AF1792| Length = 137 Score = 30.0 bits (66), Expect = 5.9 Identities = 20/57 (35%), Positives = 27/57 (47%) Frame = -3 Query: 401 EGFDRRNSNPVTIGALCASALIG*TVYHTENGQCVAAVVETKCRLVLLVLIYGYYEF 231 E RR +IGA + A++ HTE +A C LVL ++ YGYY F Sbjct: 79 ERASRRTVEIFSIGAALSGAVMLALDLHTE--AALALEFAVCCVLVLYLIFYGYYSF 133
>DPOL_RSIV (O70736) DNA polymerase (EC 2.7.7.7)| Length = 947 Score = 30.0 bits (66), Expect = 5.9 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -3 Query: 188 VYYIYLCCNVCDLLLATAGYNP 123 +YY+ N CD LL TAGY P Sbjct: 899 LYYMKSVVNACDQLLVTAGYGP 920
>SM50_STRPU (P11994) 50 kDa spicule matrix protein precursor| Length = 445 Score = 30.0 bits (66), Expect = 5.9 Identities = 10/22 (45%), Positives = 17/22 (77%) Frame = +2 Query: 422 SAYNSSPSNSPKINHPPTSNWP 487 +A++SSP++ P+ PPT +WP Sbjct: 119 AAFSSSPASPPRPGMPPTRSWP 140 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 92,035,934 Number of Sequences: 219361 Number of extensions: 1836065 Number of successful extensions: 4423 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4279 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4421 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5824436538 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)