| Clone Name | rbasd3b13 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | NU2M_CHLRE (P08740) NADH-ubiquinone oxidoreductase chain 2 (EC 1... | 30 | 6.2 | 2 | SPDYC_HUMAN (Q5MJ68) Speedy protein C (Rapid inducer of G2/M pro... | 29 | 8.1 |
|---|
>NU2M_CHLRE (P08740) NADH-ubiquinone oxidoreductase chain 2 (EC 1.6.5.3) (NADH| dehydrogenase subunit 2) Length = 382 Score = 29.6 bits (65), Expect = 6.2 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = -1 Query: 208 HLPFLCVCYLLQATLPKEAKRLAPCYLQVVFVLEF 104 H+ F+C C+L+ T P E + A C L VV + F Sbjct: 30 HIRFICQCWLVMIT-PLEVQDFALCILTVVLLQSF 63
>SPDYC_HUMAN (Q5MJ68) Speedy protein C (Rapid inducer of G2/M progression in| oocytes C) (RINGO C) (hSpy/Ringo C) Length = 293 Score = 29.3 bits (64), Expect = 8.1 Identities = 20/57 (35%), Positives = 25/57 (43%), Gaps = 5/57 (8%) Frame = -2 Query: 492 RTRRRVHRSLNRSSDRVPVAQPRSGSRHRPDHSSHSLPFHSETW-----SWQCPSVT 337 R RR H + R +VPV PR P S LP H + S +CPS+T Sbjct: 185 RDRRPHHGGVQRVCPQVPVRLPRGPGLSPPHCSPCGLPQHCSSHLLKPVSSKCPSLT 241 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 84,096,074 Number of Sequences: 219361 Number of extensions: 1733713 Number of successful extensions: 4625 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4471 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4624 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4700377760 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)